KEGG   Balaenoptera musculus (blue whale): 118904177
Entry
118904177         CDS       T09887                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
bmus  Balaenoptera musculus (blue whale)
Pathway
bmus04010  MAPK signaling pathway
bmus04014  Ras signaling pathway
bmus04015  Rap1 signaling pathway
bmus04024  cAMP signaling pathway
bmus04062  Chemokine signaling pathway
bmus04071  Sphingolipid signaling pathway
bmus04145  Phagosome
bmus04148  Efferocytosis
bmus04151  PI3K-Akt signaling pathway
bmus04310  Wnt signaling pathway
bmus04360  Axon guidance
bmus04370  VEGF signaling pathway
bmus04380  Osteoclast differentiation
bmus04510  Focal adhesion
bmus04520  Adherens junction
bmus04530  Tight junction
bmus04613  Neutrophil extracellular trap formation
bmus04620  Toll-like receptor signaling pathway
bmus04650  Natural killer cell mediated cytotoxicity
bmus04662  B cell receptor signaling pathway
bmus04664  Fc epsilon RI signaling pathway
bmus04666  Fc gamma R-mediated phagocytosis
bmus04670  Leukocyte transendothelial migration
bmus04722  Neurotrophin signaling pathway
bmus04810  Regulation of actin cytoskeleton
bmus04932  Non-alcoholic fatty liver disease
bmus04933  AGE-RAGE signaling pathway in diabetic complications
bmus04972  Pancreatic secretion
bmus05014  Amyotrophic lateral sclerosis
bmus05020  Prion disease
bmus05022  Pathways of neurodegeneration - multiple diseases
bmus05100  Bacterial invasion of epithelial cells
bmus05132  Salmonella infection
bmus05135  Yersinia infection
bmus05163  Human cytomegalovirus infection
bmus05167  Kaposi sarcoma-associated herpesvirus infection
bmus05169  Epstein-Barr virus infection
bmus05170  Human immunodeficiency virus 1 infection
bmus05200  Pathways in cancer
bmus05203  Viral carcinogenesis
bmus05205  Proteoglycans in cancer
bmus05208  Chemical carcinogenesis - reactive oxygen species
bmus05210  Colorectal cancer
bmus05211  Renal cell carcinoma
bmus05212  Pancreatic cancer
bmus05231  Choline metabolism in cancer
bmus05415  Diabetic cardiomyopathy
bmus05416  Viral myocarditis
bmus05417  Lipid and atherosclerosis
bmus05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bmus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118904177
   04014 Ras signaling pathway
    118904177
   04015 Rap1 signaling pathway
    118904177
   04310 Wnt signaling pathway
    118904177
   04370 VEGF signaling pathway
    118904177
   04071 Sphingolipid signaling pathway
    118904177
   04024 cAMP signaling pathway
    118904177
   04151 PI3K-Akt signaling pathway
    118904177
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    118904177
   04148 Efferocytosis
    118904177
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118904177
   04520 Adherens junction
    118904177
   04530 Tight junction
    118904177
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118904177
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    118904177
   04620 Toll-like receptor signaling pathway
    118904177
   04650 Natural killer cell mediated cytotoxicity
    118904177
   04662 B cell receptor signaling pathway
    118904177
   04664 Fc epsilon RI signaling pathway
    118904177
   04666 Fc gamma R-mediated phagocytosis
    118904177
   04670 Leukocyte transendothelial migration
    118904177
   04062 Chemokine signaling pathway
    118904177
  09154 Digestive system
   04972 Pancreatic secretion
    118904177
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    118904177
  09158 Development and regeneration
   04360 Axon guidance
    118904177
   04380 Osteoclast differentiation
    118904177
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118904177
   05205 Proteoglycans in cancer
    118904177
   05208 Chemical carcinogenesis - reactive oxygen species
    118904177
   05203 Viral carcinogenesis
    118904177
   05231 Choline metabolism in cancer
    118904177
  09162 Cancer: specific types
   05210 Colorectal cancer
    118904177
   05212 Pancreatic cancer
    118904177
   05211 Renal cell carcinoma
    118904177
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118904177
   05163 Human cytomegalovirus infection
    118904177
   05167 Kaposi sarcoma-associated herpesvirus infection
    118904177
   05169 Epstein-Barr virus infection
    118904177
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118904177
   05135 Yersinia infection
    118904177
   05100 Bacterial invasion of epithelial cells
    118904177
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    118904177
   05020 Prion disease
    118904177
   05022 Pathways of neurodegeneration - multiple diseases
    118904177
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118904177
   05418 Fluid shear stress and atherosclerosis
    118904177
   05415 Diabetic cardiomyopathy
    118904177
   05416 Viral myocarditis
    118904177
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    118904177
   04933 AGE-RAGE signaling pathway in diabetic complications
    118904177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bmus04131]
    118904177
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmus04147]
    118904177
   04031 GTP-binding proteins [BR:bmus04031]
    118904177
Membrane trafficking [BR:bmus04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    118904177
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    118904177
  Macropinocytosis
   Ras GTPases
    118904177
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    118904177
Exosome [BR:bmus04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118904177
  Exosomal proteins of other body fluids (saliva and urine)
   118904177
  Exosomal proteins of colorectal cancer cells
   118904177
  Exosomal proteins of bladder cancer cells
   118904177
GTP-binding proteins [BR:bmus04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    118904177
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 118904177
NCBI-ProteinID: XP_036725954
UniProt: A0A8B8YVR2
LinkDB
Position
11:13118822..13119873
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLICYTTNAFPGEYIPTVFDNYSASVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRYHCPNTPIILVGTKLDLR
DDKDMIEKLKEKKLMPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctcctg
atctgttacacgaccaatgcctttcctggagagtatatccccactgtctttgacaactat
tctgccagtgttatggtggatggaaaaccggtgaatctgggcttgtgggatacggctgga
caagaagattatgaccgattgcgccccctttcctatccgcagacagatgtattcttgatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgataccactgtcccaacactcctatcatcctggtggggacgaaacttgatctgagg
gatgataaagacatgattgagaaactgaaggagaagaagctgatgcccatcacctacccg
cagggcttggccatggccaaggagatcggtgccgtcaaatacctggagtgctcggcgctc
acgcagcgaggtctcaagacggtgtttgatgaagctatccgggcggttctctgcccgccc
cccgtcaagaagaggaagagaaaatgcctgctgttgtga

DBGET integrated database retrieval system