Balaenoptera musculus (blue whale): 118905906 Help Entry 118905906         CDS       T09887                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04613   Neutrophil extracellular trap formation bmus05034   Alcoholism bmus05202   Transcriptional misregulation in cancer bmus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bmus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118905906  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118905906   09163 Immune disease    05322 Systemic lupus erythematosus     118905906   09165 Substance dependence    05034 Alcoholism     118905906  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmus03036]     118905906   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmus04147]     118905906 Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118905906 Exosome [BR:bmus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118905906 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S VATC CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  118905906 NCBI-ProteinID:  XP_036728779 UniProt:  A0A8B8Z3W5 LinkDB All DBs Position 13:complement(30456209..30456619) Genome browser AA seq 136 aa AA seqDB search MARTKRAACKSTGGKAPRKKLATKAARKSVPSTGRLKKPQRYRPGTVALREIRRCQKCTE LLIHKLPFQQLARKIAQDFKTDLRFRSAATGALQEESEIYLAGLFEDTNLCAIHAKRVTI MPSDIRLARRLRGKHP NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcgggctgcctgcaaatcgaccggcggtaaagcaccaaggaagaaa ctggctacaaaagccgctcgcaagagtgtgccctctactggaaggctgaagaaacctcag cgttacaggcctggtaccgtggcactccgtgaaatcagacgttgtcagaagtgtactgaa cttctgattcacaaacttcccttccagcagctggcacggaaaattgctcaagacttcaaa acagatctgcgcttccggagtgcagctactggtgctttgcaggaggaaagtgagatctat ctggctgggctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaagcgacatccggctagcacgccgcttacgtggaaaacacccttaa

DBGET integrated database retrieval system