Burkholderia mallei SAVP1: BMASAVP1_A3454 Help Entry BMASAVP1_A3454    CDS       T00457                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bmv  Burkholderia mallei SAVP1 Pathway bmv00998   Biosynthesis of various antibiotics bmv01100   Metabolic pathways bmv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BMASAVP1_A3454    00074 Mycolic acid biosynthesis     BMASAVP1_A3454   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BMASAVP1_A3454 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABM50515 LinkDB All DBs Position I:3419974..3420195 Genome browser AA seq 73 aa AA seqDB search MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT VADIDALVAAQKG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system