Brucella melitensis NI: BMNI_I0471 Help Entry BMNI_I0471        CDS       T01853                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmw  Brucella melitensis NI Pathway bmw01100   Metabolic pathways bmw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BMNI_I0471    00074 Mycolic acid biosynthesis     BMNI_I0471   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BMNI_I0471 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AEQ08099 LinkDB All DBs Position I:478682..478918 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system