Halobacteriovorax marinus: BMS_1443 Help Entry BMS_1443          CDS       T01659                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bmx  Halobacteriovorax marinus Pathway bmx01100   Metabolic pathways bmx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BMS_1443    00074 Mycolic acid biosynthesis     BMS_1443   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BMS_1443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CBP_BcsR Motif Other DBs NCBI-ProteinID:  CBW26305 UniProt:  E1X078 LinkDB All DBs Position complement(1415934..1416188) Genome browser AA seq 84 aa AA seqDB search MEREQVREHVLNIIADVALDDDVTTIDDAVALRDQLDLDSMDFLDIVMELKKRHKIEVPQ EDYPQLASMNSCVEYLTPKFVALA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggaaagagaacaagtaagagaacatgtattaaatattatcgctgacgttgctctagat gatgatgtaacaactattgatgatgccgttgcgcttagagatcaactagatttagattca atggacttccttgatatcgtaatggaattaaagaagagacataagatcgaagtacctcag gaagattatcctcagctagcaagtatgaatagctgtgttgagtacctaactccaaagttt gttgcactagcataa

DBGET integrated database retrieval system