Halobacteriovorax marinus: BMS_1571 Help Entry BMS_1571          CDS       T01659                                  Name (GenBank) putative secreted protein   KO K03116   sec-independent protein translocase protein TatA Organism bmx  Halobacteriovorax marinus Pathway bmx03060   Protein export bmx03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:bmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BMS_1571  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BMS_1571  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bmx02044]     BMS_1571 Secretion system [BR:bmx02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BMS_1571 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  CBW26423 UniProt:  E1X0T5 LinkDB All DBs Position 1551524..1551790 Genome browser AA seq 88 aa AA seqDB search MFGIGGAELLIIFVFALLFIGPKKLPELARGLGKGIREFQKAKDDLLDQVNAPAETKDNT QNLASSDAPSETITTSEDNKKSSDDSNA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtttggaatcggtggagctgaattactaataatttttgtttttgcacttctctttata ggtccaaagaagttacctgagcttgcaagaggcttaggtaaagggattagagagtttcaa aaggcaaaagatgatcttcttgatcaagtaaatgctcctgccgagactaaagataacact cagaacttggcatcatctgacgcgccaagtgaaaccatcactacgtctgaggacaataaa aaatcttcagacgattctaacgcttag

DBGET integrated database retrieval system