Brugia malayi (filaria): BM_BM2610 Help Entry BM_BM2610         CDS       T01050                                  Symbol Bma-mig-2 Name (RefSeq) Uncharacterized protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bmy  Brugia malayi (filaria) Pathway bmy04145   Phagosome bmy04148   Efferocytosis bmy04310   Wnt signaling pathway bmy04361   Axon regeneration bmy04620   Toll-like receptor signaling pathway bmy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bmy00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     BM_BM2610 (Bma-mig-2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     BM_BM2610 (Bma-mig-2)    04148 Efferocytosis     BM_BM2610 (Bma-mig-2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     BM_BM2610 (Bma-mig-2)   09158 Development and regeneration    04361 Axon regeneration     BM_BM2610 (Bma-mig-2)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     BM_BM2610 (Bma-mig-2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmy04131]     BM_BM2610 (Bma-mig-2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmy04147]     BM_BM2610 (Bma-mig-2)    04031 GTP-binding proteins [BR:bmy04031]     BM_BM2610 (Bma-mig-2) Membrane trafficking [BR:bmy04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     BM_BM2610 (Bma-mig-2)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     BM_BM2610 (Bma-mig-2)   Macropinocytosis    Ras GTPases     BM_BM2610 (Bma-mig-2)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     BM_BM2610 (Bma-mig-2) Exosome [BR:bmy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BM_BM2610 (Bma-mig-2)   Exosomal proteins of other body fluids (saliva and urine)    BM_BM2610 (Bma-mig-2)   Exosomal proteins of colorectal cancer cells    BM_BM2610 (Bma-mig-2)   Exosomal proteins of bladder cancer cells    BM_BM2610 (Bma-mig-2) GTP-binding proteins [BR:bmy04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     BM_BM2610 (Bma-mig-2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  6101696 NCBI-ProteinID:  XP_001898255 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search MSAPSRQIKCVVVGDGTVGKTCMLISYTTDSFPVEYVPTVFDNFSAQMTVDGYPVNLGLW DTAGQEDYDRLRPLSYPQTDVFVLCFSIVAPVSFDNVLTKWIPEIRHNCPDAPILLIGTK LDLRDDPETLRQLNADGKQPVSKNQGQKVAKRIRAVKYLECSALTQQGLKAVFEEAVRAV IAPKPTSKNKNCTVL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgtctgctccttcacgccaaatcaaatgtgttgtggttggtgatggtaccgttggtaaa acatgtatgttgatatcgtacacgacggattcttttccagtcgaatatgttcctactgta ttcgataatttttcggcacagatgacagtagacgggtatcctgttaatttaggtttatgg gataccgctggacaagaagattacgaccgtctgcggccgctgagttacccacagactgat gtctttgtgttatgcttcagcatagtcgccccggtttcttttgataatgtgctaaccaaa tggataccagaaatacgacataactgcccggatgcaccaattcttttgataggaaccaag ctggatttacgggacgacccagagactctgaggcagctgaatgcagatggcaaacagcca gtcagcaaaaaccagggacaaaaagttgcaaagcgaatcagagccgtcaaatatcttgaa tgtagtgctttgacacagcaaggtttgaaagcagtatttgaagaagcagttcgagcagta atagcacccaaaccaactagcaaaaacaagaattgtactgttctttag

DBGET integrated database retrieval system