Brugia malayi (filaria): BM_BM9534 Help Entry BM_BM9534         CDS       T01050                                  Symbol Bma-rho-1.2 Name (RefSeq) Uncharacterized protein   KO K04513   Ras homolog gene family, member A Organism bmy  Brugia malayi (filaria) Pathway bmy04081   Hormone signaling bmy04144   Endocytosis bmy04150   mTOR signaling pathway bmy04310   Wnt signaling pathway bmy04350   TGF-beta signaling pathway bmy04361   Axon regeneration bmy04517   IgSF CAM signaling bmy04519   Cadherin signaling bmy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bmy00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     BM_BM9534 (Bma-rho-1.2)    04350 TGF-beta signaling pathway     BM_BM9534 (Bma-rho-1.2)    04150 mTOR signaling pathway     BM_BM9534 (Bma-rho-1.2)   09133 Signaling molecules and interaction    04081 Hormone signaling     BM_BM9534 (Bma-rho-1.2)    04517 IgSF CAM signaling     BM_BM9534 (Bma-rho-1.2)    04519 Cadherin signaling     BM_BM9534 (Bma-rho-1.2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     BM_BM9534 (Bma-rho-1.2)  09150 Organismal Systems   09158 Development and regeneration    04361 Axon regeneration     BM_BM9534 (Bma-rho-1.2)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     BM_BM9534 (Bma-rho-1.2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bmy04131]     BM_BM9534 (Bma-rho-1.2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmy04147]     BM_BM9534 (Bma-rho-1.2)    04031 GTP-binding proteins [BR:bmy04031]     BM_BM9534 (Bma-rho-1.2) Membrane trafficking [BR:bmy04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     BM_BM9534 (Bma-rho-1.2) Exosome [BR:bmy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BM_BM9534 (Bma-rho-1.2)   Exosomal proteins of other body fluids (saliva and urine)    BM_BM9534 (Bma-rho-1.2)   Exosomal proteins of colorectal cancer cells    BM_BM9534 (Bma-rho-1.2)   Exosomal proteins of bladder cancer cells    BM_BM9534 (Bma-rho-1.2) GTP-binding proteins [BR:bmy04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     BM_BM9534 (Bma-rho-1.2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  6101410 NCBI-ProteinID:  XP_001897966 UniProt:  A0A0K0JZL9 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKKD LRNDQQTIRELAKMKQEPVRPEQGRAIAEQIGAFAYLECSAKAKDGIREVFEKATQAALQ QKKKKKSKCDIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggcagctatccggaagaaattggttattgttggtgatggtgcttgtggcaaaacatgc ttgttgattgtatttagtaaagatcaatttcctgatgtctatgtgccaacggtttttgaa aattatgttgcggatatagaagttgatggcaagcaggtagaactagctttgtgggatacg gctggtcaagaggattatgatcgattacgcccactcagttatccggatactgatgttatt ctaatgtgctttagtatcgattcgcctgattcgcttgaaaatattcccgaaaagtggact cctgaggtgcgacatttttgtccaaatgttccaataattttggttggtaacaagaaagac cttcgaaacgatcagcagactattcgtgaattggcaaaaatgaaacaggaaccggtaaga ccggagcaaggacgtgctatcgctgagcagataggggctttcgcatatttggaatgctct gccaaagcaaaggatggtatccgcgaagtatttgagaaagccacgcaagcagcgctacag caaaagaagaagaaaaagagcaaatgtgatattctgtga

DBGET integrated database retrieval system