Bacillus mycoides ATCC 6462: BG05_4129 Help Entry BG05_4129         CDS       T03798                                  Name (GenBank) ACT domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bmyo  Bacillus mycoides ATCC 6462 Pathway bmyo00290   Valine, leucine and isoleucine biosynthesis bmyo00650   Butanoate metabolism bmyo00660   C5-Branched dibasic acid metabolism bmyo00770   Pantothenate and CoA biosynthesis bmyo01100   Metabolic pathways bmyo01110   Biosynthesis of secondary metabolites bmyo01210   2-Oxocarboxylic acid metabolism bmyo01230   Biosynthesis of amino acids Module bmyo_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bmyo_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bmyo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BG05_4129    00660 C5-Branched dibasic acid metabolism     BG05_4129   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BG05_4129   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BG05_4129 Enzymes [BR:bmyo01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BG05_4129 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT ACT_4 Motif Other DBs NCBI-ProteinID:  AJH17250 UniProt:  A0A0B5RR54 LinkDB All DBs Position complement(3996274..3996504) Genome browser AA seq 76 aa AA seqDB search MSHTFSLVIHNDPSVLLRISGIFARRGYYISSLSLNERDTSGVSEVKLTAVCTENEATLL VSQLKKLINVLQVNKL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcattagttattcataatgatccgagcgtcttattacgtataagc ggaatttttgctcggcgtggttattatatttcttctttaagcttaaacgaaagagataca agtggtgtttctgaagtgaaactaacagcagtttgtactgaaaatgaagcaacgttactt gtcagtcagttgaaaaaattaatcaatgtactgcaagtaaataaattataa

DBGET integrated database retrieval system