Brucella melitensis M28: BM28_A1223
Help
Entry
BM28_A1223 CDS
T01852
Name
(GenBank) Adenylate kinase, subfamily
KO
K00939
adenylate kinase [EC:
2.7.4.3
]
Organism
bmz
Brucella melitensis M28
Pathway
bmz00230
Purine metabolism
bmz00730
Thiamine metabolism
bmz01100
Metabolic pathways
bmz01110
Biosynthesis of secondary metabolites
bmz01232
Nucleotide metabolism
bmz01240
Biosynthesis of cofactors
Module
bmz_M00049
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:
bmz00001
]
09100 Metabolism
09104 Nucleotide metabolism
00230 Purine metabolism
BM28_A1223
09108 Metabolism of cofactors and vitamins
00730 Thiamine metabolism
BM28_A1223
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
bmz04147
]
BM28_A1223
Enzymes [BR:
bmz01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.4 Phosphotransferases with a phosphate group as acceptor
2.7.4.3 adenylate kinase
BM28_A1223
Exosome [BR:
bmz04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
BM28_A1223
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ADK
AAA_17
Hydin_ADK
AAA_33
AAA_18
Cytidylate_kin
SRP54
CdsD_PD2
AAA_28
NtrY_N
Motif
Other DBs
NCBI-ProteinID:
ADZ66299
LinkDB
All DBs
Position
1:complement(1208912..1209496)
Genome browser
AA seq
194 aa
AA seq
DB search
MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS
DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL
VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRIINGMAPV
EEVTAEIERILVPA
NT seq
585 nt
NT seq
+upstream
nt +downstream
nt
atgagactgatacttcttgggccgcccggagcaggtaaggggacgcaggctggacttctt
accaagaagcatggaatacctcagctctcgaccggcgatatgctgcgcgcggcagtcgct
cagcagagcgagatcgggaagcgcgccaaggccgtgatggatgccgggcaactggtttcc
gacgagatcgtgaaccagatcgtttcggaacggatcgatgcgccggactgtgcgaatggt
ttcattctcgacggctatccgcgcactgtgccgcaggctcaggccttgagccagatgctg
tcgggcaaggggcttaagctggatgccgtcatcgagctgaaggtcgatgagaatgctctg
gtcaagcggatggaaagccgtgtggccgaaacgattgccaagggcggtcaggtccgttcg
gacgacaacccggaagccttccgcaagcgtcttgtggaataccgcgaaaagactgcgccg
ctttcaagctattatgccggaaccggcgaactgcgcatcatcaatggcatggcgccggtt
gaagaagtcaccgccgaaatcgagagaattcttgttccggcctga
DBGET
integrated database retrieval system