KEGG   Brassica napus (rape): 106346576
Entry
106346576         CDS       T04128                                 
Name
(RefSeq) cystine lyase CORI3-like
  KO
K21623  L-cystine beta-lyase [EC:4.4.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106346576
Enzymes [BR:bna01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.35  L-cystine beta-lyase
     106346576
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3
Other DBs
NCBI-GeneID: 106346576
NCBI-ProteinID: XP_013641401
LinkDB
Position
C1:15310585..15312970
AA seq 424 aa
MATTPMCTEWQFSGNEAAKEAAAAALGAYTSKLMALCDPNGKPILPPSNKAVETSNSAEK
AVVKVILSGTGNAYAPSIGLPLAKSAVAEYLNRDLPKKLTAADVFMTVGCKRAIDLAVDI
LAKPKANVLLPRPGFPWDVVRCIYKKLEVRYYDFIPEQNFEIDFESVKKVTDKNTFAIFI
INPHNPNGNTYSEAHLKQLAELAKELSIMVVSDEVFRWTVFGNNPFVPMGKFSSIVPVVT
LGSLSKGWNVPGWRTGWLALHDLDGVFRNTKILQAANEFLQINAKPPTVIQAAMPDILER
TPKHFFHERGSFLKHKVDIGYSKVKHIPGLTCYMKPEACTFLWTKLDISCFADIEDDQDF
CRKLAMEENLVVLPGIAFRQKNWLRHSIDMETQTVEDAFERLKSFCERHSAERGASLKNV
NGVN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgaccacccccatgtgcactgagtggcagttcagcgggaacgaggcagccaaagaa
gctgctgcggccgccctaggtgcctacacctctaaactcatggctctttgtgatcctaat
ggcaagcccattttgcccccgagtaacaaggccgtggagaccagcaattcagcggaaaag
gctgtcgttaaagttattctctccggcactggaaacgcctatgctcctagcattggcctt
ccgctcgccaaaagtgccgtagcagagtatctaaacagagatcttccaaagaagctaaca
gcagctgacgtgtttatgactgttggatgcaaacgagcaattgaccttgcggtggatatt
ctggctaaaccaaaagccaacgttttgcttccgaggccaggcttcccgtgggatgtagta
cgctgcatctataagaaactcgaggtccgttactatgatttcatccctgaacaaaacttt
gagatcgacttcgaaagcgtcaaaaaggtgacagacaagaacacctttgctatatttatc
atcaaccctcacaatcccaatggaaacacttactcggaggctcatctcaaacagctcgct
gaattggctaaggaactctcgattatggtggtttctgatgaagtttttagatggaccgtc
ttcgggaataacccttttgtgccgatgggaaagttttcttccatcgtaccagtggttaca
ctcggatccttatctaagggatggaatgtcccaggatggcgaactggctggctcgcgctg
cacgatctagacggtgtcttcagaaacactaagatattacaagctgccaacgaatttctc
cagataaatgccaaacctccgactgttattcaggcggctatgcctgacattttggagaga
actccaaaacatttcttccacgagaggggaagttttctgaaacataaagtagatattgga
tattctaaggtcaagcacatacctggcctcacttgttacatgaaacccgaagcgtgcacc
tttttatggaccaagctggatatatcgtgctttgctgacattgaagacgatcaagacttc
tgcaggaagcttgctatggaagaaaatctcgtcgttttgccagggattgcatttaggcag
aagaattggctgaggcattctatcgacatggagacgcaaacagttgaggacgcatttgaa
agattgaagagcttctgtgaacgccattccgctgaacgtggagcttcactcaaaaacgtc
aatggcgtgaactag

DBGET integrated database retrieval system