KEGG   Brassica napus (rape): 106353183
Entry
106353183         CDS       T04128                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106353183
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106353183
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     106353183
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 106353183
NCBI-ProteinID: XP_013648344
LinkDB
Position
A3:complement(23671719..23674702)
AA seq 589 aa
MAAATSSIAPSLSCPSPSSSSKSLRSSKATTFAFPNIGSLSSTSKSLRSLTATVAGNGAG
SSLSARMVASSAVRAPMSLDFETSVFKKEKVSLAGHEEYIVRGGRDLFKHLPDAFKGIKQ
IGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAVGFTEESGTLGDIW
ETISGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVV
AVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATT
LEQEYKSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTISTQ
GMLAVYNSLTEEGKKDFETAYSASFYPCMEILYECYEDVAAGSEIRSVVLAGRRFYDKEG
LPAFPMGKIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYS
EIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYNLTQQALVAVDNG
APINKDLISNFFADPVHGAIQVCAELRPTVDISVPQDADFVRPELRQSN
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccatcgctccttccctctcgtgcccatctccttcttcttcc
tccaaatcccttaggtcctcgaaagccacaacctttgctttccccaacatcggttccctc
tcgtctacttcaaagtctctgaggtccctcactgccaccgtcgctggaaatggtgccgga
tcttccctctccgcgcgaatggttgcgtcctctgcggttagagcccctatgtctctagat
ttcgagacgtctgtgttcaaaaaggagaaagtctctcttgctggtcacgaagagtacatt
gtgagaggaggaagggacttgttcaagcatcttcctgatgctttcaaggggattaagcag
attggtgtcattggctggggatctcagggacctgctcaagctcagaatttaagggattcc
cttgtggaggcaaagtctgacattgttgttaagattgggcttagaaagggctctcgctca
tttgaggaagcacgtgctgttggcttcaccgaagaaagcggtactctgggtgatatatgg
gaaactatctctggcagtgatcttgtgttgctcttgatctctgatgctgctcaggctgat
aactatgagaaaatattctcccacatgaagccaaacagcattctcggtttgtcacacggg
tttctactgggccatttacagtccatgggactcgatttcccaaagaacatcagtgtggta
gctgtttgccctaagggaatgggtccatctgtgagaaggctttatgtccaaggcaaagaa
atcaacggtgctggaatcaacgccagttttgctgtccaccaggatgttgatgggagagcc
gctgatgttgctctgggatggtcagtagcacttggttctccttttacttttgcaactact
cttgagcaagagtacaagagtgacatctttggagaaagaggtatcttgcttggtgctgtt
cacggaatcgtggagtccctgttcagaaggtacactgaaaatggaatgagtgaagactta
gcttacaagaacacagtagagtgcatcacaggaacaatctcaaggactatctctacccag
ggaatgttggctgtctacaactccttgactgaagaaggcaaaaaggatttcgagactgca
tacagtgcatccttctatccatgtatggagatcctctatgaatgttacgaggatgtagca
gctggcagcgaaatcaggagtgttgtcttagccggtcgtcgcttctacgataaggagggc
ttgcctgcattcccaatgggaaagattgatcagacaagaatgtggaaggtcggtgaacgc
gtcaggaagtccagaccagctggtgacttgggtcccttgtatcccttcaccgctggagtt
tacgttgccctcatgatggctcagattgagatcttgaggaagaagggtcactcctactca
gagatcatcaacgagagtgtgatcgagtctgttgattctctgaacccgtttatgcacgct
agaggagtgtccttcatggtggacaactgctcgaccacagcaaggttgggatcgaggaaa
tgggcaccaaggtttgactacaacctgacccaacaagctctggtggctgtggacaatggt
gcaccaatcaacaaagacttgatcagcaacttcttcgctgatccagtccatggtgctatc
caggtctgcgcagagctcaggcctaccgtggatatctcagtgcctcaagatgcagatttt
gttcgaccagagctgcgtcagtccaactag

KEGG   Brassica napus (rape): 106368142
Entry
106368142         CDS       T04128                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic-like
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106368142
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106368142
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     106368142
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 106368142
NCBI-ProteinID: XP_013663492
LinkDB
AA seq 586 aa
MAAATSSIASPLSCPSLSSSLRSSKATSFALPSISFVSSTSKSLRSLTATVPGNGTGSSL
SARMVASSAVRAPVSLDFETSVFKKEKVSLAGYDEYIVRGGRDLFKHLPDAFKGIKQIGV
IGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSKSFEEARAVGFTEESGTLGDIWETI
SGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVVAVC
PKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATTLEQ
EYKSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTISTQGML
AVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVAAGSEIRSVVLAGRRFYDKEGLPA
FPMGKIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEII
NESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYNLTQQALVAVDSGAPI
NKDLISNFFADPVHGAIEVCAQLRLTVDISVPEDADFVRPELRQSS
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggcggctgctacttcatccatcgcttctcccctctcgtgcccgtctctttcttcttcc
ctcaggtcatcgaaagccacaagctttgctttgcccagcatcagtttcgtctcctctact
tcaaagtctctgaggtcgctcactgccaccgtccctggaaatggaaccggatcttccctc
tccgcgaggatggttgcgtcgtctgcggtcagagcacctgtttctctcgatttcgagacg
tctgtgttcaaaaaggagaaggtctctcttgctggttacgatgagtacattgtgagagga
ggaagggacttgttcaagcatcttcctgatgctttcaaagggattaagcagattggtgtc
attggctggggctctcagggacctgctcaagctcagaatctaagggattcacttgtggag
gctaagtctgacattgttgttaagattgggcttagaaagggttctaaatcgtttgaggag
gcacgtgctgttggcttcaccgaagagagtggtactttgggtgatatatgggaaaccatc
tctggtagtgatctcgtgttgcttttgatctctgatgctgctcaggctgataactatgag
aaaatattctcacacatgaagccaaacagcattctcggtttgtcacacgggtttctacta
gggcatttacagtcaatgggacttgatttcccaaagaacatcagcgtggtagctgtttgc
cctaagggaatgggtccatccgtgaggaggctttatgtccaaggcaaagaaatcaacggt
gctggaatcaacgctagttttgcagtccaccaggatgttgacggtagagccgctgatgtt
gctctgggatggtcagtagcacttggttctccttttacttttgctactactcttgagcaa
gagtacaagagtgacatctttggagaaagaggtattttgcttggtgcggttcacggaatc
gtggagtctctctttagaaggtacactgaaaatggaatgagcgaagacttggcttacaag
aacacagtagagtgcatcacaggaacaatctcaaggactatctctactcagggcatgttg
gctgtctacaactccttgtctgaagaaggcaaaaaggacttcgagactgcatacagcgca
tccttctacccttgtatggagattctctacgaatgttacgaggatgtagcagctggcagc
gagatccggagtgttgtcttagccggtcgtcgcttctatgataaggagggcttgcctgca
ttcccaatgggtaagattgatcagacaagaatgtggaaggtcggtgaacgtgtcaggaag
tccagaccagctggtgacttgggtccgttgtatcccttcaccgctggagtttacgttgcc
cttatgatggctcagattgagatcttgaggaagaagggtcactcatactcggagatcatc
aacgagagtgtgattgaatctgttgattctctgaatccgtttatgcacgctagaggagtg
tccttcatggtggacaactgctcgaccacagcgagattgggatcgaggaaatgggcaccg
aggttcgactacaacctgacgcaacaagctttagtggctgtggacagtggtgcaccaatc
aacaaagatttgataagcaacttctttgctgatccagtccatggtgctatcgaggtctgt
gcacagctcaggcttaccgttgatatctctgtgcctgaagatgcagattttgttcgacct
gagctgcgtcagtctagctga

KEGG   Brassica napus (rape): 106368280
Entry
106368280         CDS       T04128                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic-like isoform X2
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106368280
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106368280
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     106368280
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 106368280
NCBI-ProteinID: XP_013663654
LinkDB
Position
C8:31955059..31958986
AA seq 581 aa
MAAATSSIAPPLSCPSKALRSSKATSLAFGFVSSTSKSLRSLTATVPGNGTGSSLSARMV
ASSAVRAPVSLDFETSVFKKEKVSLAGYDEYIVRGGRDLFKHLPDAFKGIKQIGVIGWGS
QGPAQAQNLRDSLVEAKSDIVVKIGLRKGSKSFEEARAVGFTEESGTLGDIWETISGSDL
VLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVVAVCPKGMG
PSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATTLEQEYKSD
IFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTISTKGMLAVYNS
FSEEGKKDFETAYSASFYPCMEILYECYEDVAAGSEIRSVVLAGRRFYDKEGLPAFPMGK
IDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVI
ESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYNLTQQALVAVDSGAPINKDLI
SNFFADPVHGAIEVCAQLRPTVDISVPEDADFVRPELRQSS
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggcggctgcaacttcatccatcgctcctcccctctcatgcccatccaaagcccttagg
tcatcgaaagccacaagcttggcttttggtttcgtctcgtctacttcaaagtcactgagg
tcgctcactgccaccgtccctggaaatggaaccggatcttccctctccgcgagaatggtt
gcgtcgtctgcggtcagagcacctgtgtctctcgatttcgagacgtctgtgttcaaaaag
gagaaagtctctctcgctggctacgatgagtacattgtgagaggaggaagggacttgttc
aagcatcttcctgatgctttcaaagggattaagcagattggtgtcattggctggggctct
cagggacctgctcaagctcagaatctaagggattcacttgtggaggctaagtctgacatt
gttgttaagattgggcttagaaagggatctaaatcgtttgaggaggcacgtgctgttggc
ttcaccgaagagagtggtactttgggtgatatatgggaaactatctctggcagcgatctt
gtattgcttttgatctctgatgctgctcaggctgataactatgagaaaatattctcacac
atgaagccaaacagcattctcggcttgtcacacgggtttctactagggcatttacagtca
atgggacttgatttcccaaagaacatcagcgtggtagctgtttgccctaagggaatgggt
ccatccgttaggaggctttatgtccaaggcaaagaaatcaacggtgctggaatcaacgct
agttttgcagtccaccaggatgttgacggtagagccgctgatgttgctctgggatggtca
gtagcacttggttctccgtttacttttgctactactcttgagcaagagtacaagagtgac
atcttcggagaaagaggtattttgcttggtgcggttcacggaatcgtggagtctctcttt
agaaggtacactgagaatggaatgagcgaagacttagcttacaagaacacagtagagtgc
atcacaggaacaatctcaaggactatctctactaagggcatgttggctgtctacaactcc
ttctctgaagaaggcaaaaaggacttcgagactgcatacagcgcatccttctacccttgt
atggagattctctacgaatgttacgaggatgtagcagctggcagcgagatccggagtgtt
gtcttggccggtcgtcgcttctatgataaggagggattgcctgcattcccgatgggtaag
attgatcagacaagaatgtggaaggtcggtgaacgtgtcaggaagtccagaccagctggt
gacttgggtccgttgtatcccttcaccgctggagtttacgttgcccttatgatggctcag
attgagatcttgaggaagaagggtcactcatactcggagatcatcaacgagagtgtgatt
gaatctgttgattctctcaatccgtttatgcacgctagaggagtgtccttcatggtggac
aactgctcgaccacagcgagattgggatcgaggaaatgggcaccgaggttcgactacaac
ctgactcaacaagctttggtggctgtggacagtggtgcaccaatcaacaaagacttgata
agcaacttctttgctgatccagtccatggtgctatcgaggtctgtgcacagctcaggcct
accgttgatatctctgtgcctgaagatgcagattttgttcgacctgagctgcgtcagtct
agctga

KEGG   Brassica napus (rape): 106396158
Entry
106396158         CDS       T04128                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic-like
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106396158
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106396158
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     106396158
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 106396158
NCBI-ProteinID: XP_013691934
LinkDB
Position
A4:3506175..3509197
AA seq 586 aa
MAAATSSIASPLSCPSLSSSLRSSKATSFALPSISFVSSTSKSLRSLTATVPGNGTGSSL
SARMVASSAVRAPVSLDFETSVFKKEKVSLAGYDEYIVRGGRDLFKHLPDAFKGIKQIGV
IGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSKSFEEARAVGFTEESGTLGDIWETI
SGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVVAVC
PKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATTLEQ
EYKSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTISTQGML
AVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVAAGSEIRSVVLAGRRFYDKEGLPA
FPMGKIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEII
NESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYNLTQQALVAVDSGAPI
NKDLISNFFADPVHGAIEVCAQLRPTVDISVPEDADFVRPELRQSS
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggcggctgctacttcatccatcgcttctcccctctcgtgcccgtctctttcttcttcc
ctcaggtcatcgaaagccacaagctttgctttgcccagcatcagtttcgtctcctctact
tcaaagtctctgaggtcgctcactgccaccgtccctggaaatggaaccggatcttccctc
tccgcgaggatggttgcgtcgtctgcggtcagagcacctgtttctctcgatttcgagacg
tctgtgttcaaaaaggagaaggtctctcttgctggttacgatgagtacattgtgagagga
ggaagggacttgttcaagcatcttcctgatgctttcaaagggattaagcagattggtgtc
attggctggggctctcagggacctgctcaagctcagaatctaagggattcacttgtggag
gctaagtctgacattgttgttaagattgggcttagaaagggttctaaatcgtttgaggag
gcacgtgctgttggcttcaccgaagagagtggtactttgggtgatatatgggaaaccatc
tctggtagtgatctcgtgttgcttttgatctctgatgctgctcaggctgataactatgag
aaaatattctcacacatgaagccaaacagcattctcggtttgtcacacgggtttctacta
gggcatttacagtcaatgggacttgatttcccaaagaacatcagcgtggtagctgtttgc
cctaagggaatgggtccatccgtgaggaggctttatgtccaaggcaaagaaatcaacggt
gctggaatcaacgctagttttgcagtccaccaggatgttgacggtagagccgctgatgtt
gctctgggatggtcagtagcacttggttctccttttacttttgctactactcttgagcaa
gagtacaagagtgacatctttggagaaagaggtattttgcttggtgcggttcacggaatc
gtggagtctctctttagaaggtacactgaaaatggaatgagcgaagacttggcttacaag
aacacagtagagtgcatcacaggaacaatctcaaggactatctctactcagggcatgttg
gctgtctacaactccttgtctgaagaaggcaaaaaggacttcgagactgcatacagcgca
tccttctacccttgtatggagattctctacgaatgttacgaggatgtagcagctggcagc
gagatccggagtgttgtcttagccggtcgtcgcttctatgataaggagggcttgcctgca
ttcccaatgggtaagattgatcagacaagaatgtggaaggtcggtgaacgtgtcaggaag
tccagaccagctggtgacttgggtccgttgtatcccttcaccgctggagtttacgttgcc
cttatgatggctcagattgagatcttgaggaagaagggtcactcatactcggagatcatc
aacgagagtgtgattgaatctgttgattctctgaatccgtttatgcacgctagaggagtg
tccttcatggtggacaactgctcgaccacagcgagattgggatcgaggaaatgggcaccg
aggttcgactacaacctgacgcaacaagctttagtggctgtggacagtggtgcaccaatc
aacaaagatttgataagcaacttctttgctgatccagtccatggtgctatcgaggtctgt
gcacagctcaggcctaccgttgatatctctgtgcctgaagatgcagattttgttcgacct
gagctgcgtcagtctagctga

KEGG   Brassica napus (rape): 106415217
Entry
106415217         CDS       T04128                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic-like
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106415217
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106415217
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     106415217
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 106415217
NCBI-ProteinID: XP_013711314
LinkDB
Position
C7:complement(22648411..22651697)
AA seq 589 aa
MAAATSSIAPSLTCPSASSSSKALRSSKVSTFAFPNIGFTSSASKSLRSLSAAVSGNGTG
SSLAARMVASSAVRAPISLDFETSVFKKEKVSLAGHEEYIVRGGRDLFKHLPDAFKGIKQ
IGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSKSFEEARAVGFTEESGTLGDIW
ETISGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVV
AVCPKGMGPSVRRLYVQGKEVNGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFATT
LEQEYKSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGNISRTISTQ
GMLAVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVAAGSEIRSVVLAGRRFYDKEG
LPAFPMGKIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYS
EIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYNLTQQALVAVDNG
APINKDLISNFFADPVHGAIEVCAQLRPTVDISVPEDADFVRPELRQSN
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccatcgctccttccctcacatgcccatctgcttcttcctcc
tccaaagccctcaggtcatcgaaagtctcaacctttgctttccccaacatcggtttcacc
tcctctgcttccaagtctctgaggtctctctccgccgccgtctccggaaatggcaccgga
tcttccctcgccgcgagaatggtcgcgtcgtctgcggtcagagcgcctatttctctagac
ttcgagacgtctgtgttcaaaaaggagaaagtatctcttgctggtcacgaagagtacatt
gtgagaggaggaagggacttgtttaagcatctccctgatgctttcaaagggattaagcag
attggtgtcattggctggggttctcagggacctgctcaagctcagaatttaagggattca
cttgtggaggcaaagtctgacattgttgttaagattggtcttagaaagggctctaaatcg
tttgaggaggcacgtgctgttggcttcaccgaagaaagtggtactttgggtgatatatgg
gaaactatctccggcagtgatcttgtattgcttttgatctctgatgctgctcaagctgat
aactatgagaaaatattctctcacatgaaaccaaacagcattctcggtttgtcacatggg
ttcttactggggcatttacagtcaatgggacttgacttcccaaagaacatcagcgtggta
gctgtttgccctaaaggaatgggtccatctgtgagaaggctttatgtccaaggcaaagaa
gtcaacggtgctggaatcaacgccagttttgctgtccaccaggatgttgatggtagagcc
gcagatgttgctctaggatggtcagtagcacttggttctccttttacctttgctactact
cttgagcaagagtacaagagtgacatctttggagaaagaggtattttgcttggtgccgtt
cacggaatagtggagtctctgttcagaaggtacactgagaacggaatgagtgaagacttg
gcttacaagaacacagtagagtgcatcacaggaaacatttctagaactatctctactcag
ggaatgttggctgtctacaactccttgtccgaagaaggcaaaaaagatttcgagactgcc
tacagtgcatccttctatccttgcatggagattctctatgaatgctacgaggatgtagca
gctggcagcgagatcaggagtgttgtcttagccggtcgtcgcttctacgataaggagggc
ttgcctgcctttccaatgggaaagattgatcagacaagaatgtggaaggtcggtgaacgt
gtcaggaagtcaagaccagctggtgacttgggtccgttgtatcccttcactgctggagtt
tacgttgcccttatgatggctcagatcgagatcttgaggaagaagggtcactcttactca
gagatcatcaacgagagtgtgattgagtctgttgactctctaaacccgtttatgcatgcc
agaggagtgtcattcatggtggacaactgctcgaccactgcaagattgggatcgaggaaa
tgggcaccgagattcgactacaatctgactcaacaagctttggtggctgtggacaatggt
gcaccgatcaacaaagacttgatcagcaacttctttgctgatccagtccatggtgctatt
gaggtgtgtgcacagctcaggcctaccgttgatatctctgtgcctgaagatgctgatttt
gttcgaccagagctccgtcagtccaactga

KEGG   Brassica napus (rape): 106428249
Entry
106428249         CDS       T04128                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic-like
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106428249
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106428249
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     106428249
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 106428249
NCBI-ProteinID: XP_013724452
LinkDB
Position
C6:25468018..25471034
AA seq 591 aa
MAAATSSIAPSLSCPSPSSSSKALRSSKATTFAFPNIGSLSSTSKSLRSLTATVAGNGTG
SSLSARMVASSAVRAPMSLDFETSVFKKEKVSLAGHEEYIVRGGRDLFKHIPDAFKGIKQ
IGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAVGFTEETGTLGDIW
ETISGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSMGLDFPKNISVV
AVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTPSIL
EFSRRWRITSLHGFYGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTIS
TQGMLAVYNSLSEEGKKDFEIAYSASFYPCMEILYECYEDVAAGSEIRSVVLAGRRFYDK
EGLPAFPMGKIDQTRMWKVGERVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHS
YSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYNLTQQALVAVD
NGAPINKDLISNFFADPVHGAIQVCAELRPTVDISVPQDADFVRPELRQSN
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccatcgctccttccctctcatgcccatctccttcttcttcc
tccaaagcccttaggtcatcgaaagccacaacctttgctttccccaacatcggttccctc
tcgtctacttccaagtctctgaggtccctcactgccaccgtcgctggaaatggtaccgga
tcttccctctccgcgcgaatggttgcttcgtctgcggttagagcccctatgtctctagat
ttcgagacgtctgtgttcaaaaaagagaaagtctctcttgctggtcacgaagagtacatt
gtgagaggaggaagggacttgttcaagcatattcctgatgctttcaaagggattaagcag
attggtgtcattggctggggatctcagggacctgctcaagctcagaatttaagggattcc
cttgtggaggcaaagtctgacatcgttgttaagattgggcttagaaagggctctcgctca
tttgaggaagcacgtgctgttggcttcaccgaagaaaccggtactctcggtgatatatgg
gaaactatctctggcagtgatcttgtgttgctcttgatctctgatgctgctcaggctgat
aactatgagaaaatattctcccacatgaagccaaacagcattctcggtttgtcacacggg
tttctactgggccatttacagtccatgggactcgatttcccaaagaacatcagtgtggta
gctgtttgccctaagggaatgggtccatccgtgagaaggctttatgtccaaggcaaagaa
atcaacggtgctggaatcaacgccagttttgctgtccaccaggatgttgacggtagagcc
gccgatgttgctctgggatggtcagtagcacttggttctccttttactccatctattcta
gagttttctcgcagatggaggatcaccagtttgcatggattctatggtatcctgcttggt
gctgttcacggaatcgtggagtccctgttcagaaggtacaccgaaaatggaatgagtgaa
gacttagcttacaagaacacagtagagtgcatcacaggaacaatctcaaggactatctct
acccagggaatgttggctgtgtacaactccttgtctgaagaaggcaaaaaggactttgag
attgcatacagtgcatccttctatccttgtatggagatcctctatgaatgctacgaggat
gtagcagctggcagcgaaatcaggagtgttgtcttagccggtcgtcgcttctacgataag
gagggtttgcctgcattcccaatgggaaagattgatcagacaagaatgtggaaggtcggt
gaacgtgtcaggaagtccagaccagctggtgacttgggtcccttgtatcccttcacagca
ggagtttacgttgcccttatgatggctcagatcgagatcttgaggaagaagggtcattcc
tactcagagatcatcaacgagagtgtcattgagtctgttgattctctgaacccctttatg
cacgctagaggagtgtccttcatggtggacaactgctcgaccacagcaaggttgggatcg
aggaaatgggcaccaaggtttgactacaacctgacccaacaagctctggtggctgtggac
aatggtgcaccaatcaacaaagacttgatcagcaacttcttcgctgatccagtccatggt
gctatccaggtctgcgcagagctcaggcctaccgtggatatctcagtgcctcaagatgca
gattttgttcgaccagagctgcgtcagtccaactag

DBGET integrated database retrieval system