KEGG   Brassica napus (rape): 106354366
Entry
106354366         CDS       T04128                                 
Name
(RefSeq) cytosolic sulfotransferase 16
  KO
K11821  aromatic desulfoglucosinolate sulfotransferase [EC:2.8.2.24]
Organism
bna  Brassica napus (rape)
Pathway
bna00380  Tryptophan metabolism
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
Module
bna_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    106354366
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106354366
Enzymes [BR:bna01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.24  aromatic desulfoglucosinolate sulfotransferase
     106354366
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 106354366
NCBI-ProteinID: XP_013649738
UniProt: A0A078E3L3
LinkDB
Position
A7:complement(24850882..24852138)
AA seq 338 aa
MEPNTTQNGSQLKLSEFEKTQKKYQDFISALPKSKGWRPNEILTQYNGHWWQECLLEGLL
HAKDHFQARPTDFLVCSYPKTGTTWLKALTYAIVNRSRFDDATNPLLKRNPHEFVPYVEI
DFAFYPTVDVLQDGKNQLYSTHIPNGSLPESIVKSGCKMVYIWRDPKDTFISMWTFLHKE
KSQEGQQLASLEEAFDMFCKGLSVYGPYLDHVLGYWKAYKENPERILFLRYETMRADPLP
FVKRLAEFMGYGFSDEEEENGVAENVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYF
RKGKVGDWANYLTPEMAARIDGLVEETFKDTGLLQHDQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaacccaacacgacccaaaacggatcccaactcaagctctcagagttcgagaaaacc
caaaagaagtaccaagacttcatctccgccctcccaaagagcaaaggatggagaccaaac
gagatcctaacccaatacaacggacactggtggcaagaatgtctcctcgaaggcctcctc
cacgccaaagaccatttccaagcacgacccaccgacttcctcgtctgcagctaccccaaa
accggcacaacctggctcaaagccttaacttacgccatcgtaaaccgttcacgtttcgac
gacgcaacgaacccgctcctcaaacgtaaccctcacgagttcgtgccttacgtcgagata
gacttcgcgttctacccgaccgtggacgtccttcaagacggcaagaaccagctttactcc
acccatatacccaacgggtcgttaccggagtcgatagtgaagtccggttgcaagatggtt
tacatttggagagacccgaaggacactttcatctccatgtggactttcctccacaaggag
aagtctcaagagggtcagcagctagcgagtctcgaagaggcttttgatatgttctgtaaa
ggcttgtctgtgtacggtccttatctggatcatgtgttgggttactggaaggcttacaaa
gagaatccggagaggattctcttcctgaggtacgagacgatgagagctgatcctttgccc
tttgtgaagaggttggctgagttcatgggttatgggtttagtgatgaggaagaggagaat
ggtgttgctgagaatgtagtgaagctttgtagttttgagacgttgaagaatcttgaagct
aacaaaggagataaggagagggaggaccgtcctgcggtttatgcgaatagcgcgtatttt
aggaaaggaaaggttggagattgggcgaattatctgactccagagatggctgctcgtatc
gatgggttagtggaagagacgttcaaagatactggcttgcttcaacatgatcagtga

DBGET integrated database retrieval system