Brassica napus (rape): 106377041 Help Entry 106377041         CDS       T04128                                  Name (RefSeq) ubiquitin-like protein ATG12B   KO K08336   ubiquitin-like protein ATG12 Organism bna  Brassica napus (rape) Pathway bna04136   Autophagy - other Brite KEGG Orthology (KO) [BR:bna00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     106377041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bna04131]     106377041    04121 Ubiquitin system [BR:bna04121]     106377041    03029 Mitochondrial biogenesis [BR:bna03029]     106377041 Membrane trafficking [BR:bna04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     106377041 Ubiquitin system [BR:bna04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    106377041 Mitochondrial biogenesis [BR:bna03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     106377041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  106377041 NCBI-ProteinID:  XP_048614724 LinkDB All DBs Position C5:49946190..49947604 Genome browser AA seq 94 aa AA seqDB search MATESPSSVRKIVVHLRATGGAPILKQNKFKISGTDKFAKVIDFLGRQLHSDSLFVYVNS AFSPNPDESVIDLYNNFGIDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcgacggagtcgccgagctccgttcggaaaattgttgttcatctaagagctacagga ggtgctccaatactgaaacaaaataagttcaagatttcagggacggataagtttgctaaa gtgattgactttctaggaaggcagcttcactctgactcattgtttgtgtatgtaaacagt gctttctcgccaaaccctgatgaatcagtaattgatctatacaataactttgggatagat gggaaactggtggtgaactatgcttgttccatggcatggggataa

DBGET integrated database retrieval system