Brassica napus (rape): 106386330 Help Entry 106386330         CDS       T04128                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism bna  Brassica napus (rape) Pathway bna04016   MAPK signaling pathway - plant bna04070   Phosphatidylinositol signaling system bna04075   Plant hormone signal transduction bna04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:bna00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     106386330    04070 Phosphatidylinositol signaling system     106386330    04075 Plant hormone signal transduction     106386330  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     106386330  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bna01009]     106386330   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bna04131]     106386330    03036 Chromosome and associated proteins [BR:bna03036]     106386330   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bna04147]     106386330 Protein phosphatases and associated proteins [BR:bna01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106386330 Membrane trafficking [BR:bna04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     106386330 Chromosome and associated proteins [BR:bna03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      106386330 Exosome [BR:bna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106386330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH Dockerin_1 EF_EFCAB10_C EF-hand_11 EFhand_Ca_insen DUF5580_M FCaBP_EF-hand DUF7200 SPARC_Ca_bdg YqeY PA_Ig-like DUF5644 SPEF2_C Motif Other DBs NCBI-GeneID:  106386330 NCBI-ProteinID:  XP_048609122 LinkDB All DBs Position C3:29375775..29377753 Genome browser AA seq 114 aa AA seqDB search MINGYLCHSHYSELQDMINEVDADGNGTIDFSDFLNLMAKKMKDTDSKEELKEAFRVFDK DQNGFISAAELCHVMTNLGEKLTDEEVEEIVREADVDGDGQKNYEEFVKIMMAK NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgatcaacgggtatttgtgtcattcacactattctgagctccaggacatgatcaacgag gttgatgctgatggaaacggaaccatcgacttttccgacttcctgaaccttatggctaag aagatgaaggacactgactcaaaggaagagctaaaagaagcatttagggttttcgacaaa gaccagaacggtttcatctccgctgctgagctatgccatgtgatgaccaatctcggtgag aagctgactgatgaggaagtcgaagagatagtccgtgaggctgatgttgatggagatggt cagaaaaactatgaagagtttgtcaaaattatgatggctaagtga

DBGET integrated database retrieval system