Brassica napus (rape): 106386973 Help Entry 106386973         CDS       T04128                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism bna  Brassica napus (rape) Pathway bna04016   MAPK signaling pathway - plant bna04070   Phosphatidylinositol signaling system bna04075   Plant hormone signal transduction bna04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:bna00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     106386973    04070 Phosphatidylinositol signaling system     106386973    04075 Plant hormone signal transduction     106386973  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     106386973  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bna01009]     106386973   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bna04131]     106386973    03036 Chromosome and associated proteins [BR:bna03036]     106386973   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bna04147]     106386973 Protein phosphatases and associated proteins [BR:bna01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106386973 Membrane trafficking [BR:bna04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     106386973 Chromosome and associated proteins [BR:bna03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      106386973 Exosome [BR:bna04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106386973 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  106386973 NCBI-ProteinID:  XP_013682252 UniProt:  A0A078FUD5 LinkDB All DBs Position C3:complement(5421237..5422421) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctgaccgatgaccagatctcagagttcaaggaagcctttagcctcttc gataaggatggagatggttgcatcaccaccaaggagctgggaaccgtgatgaggtctctg gggcaaaacccaactgaagctgagctccaagacatgatcaatgaggtcgatgcagacggg aacgggaccatagatttccccgagttcctgaacctgatggcaaggaagatgaaggacact gattcagaggaagagctcaaggaagccttcagggtttttgataaagaccagaacggtttc atctctgcggcagagcttcgacatgtgatgacaaaccttggggagaagctcaccgacgag gaggttgatgagatgatccgagaagctgatgttgatggagatggtcagatcaactatgat gaattcgttaaagtcatgatggctaagtga

DBGET integrated database retrieval system