KEGG   Brassica napus (rape): 106411693
Entry
106411693         CDS       T04128                                 
Name
(RefSeq) cytosolic sulfotransferase 18
  KO
K22321  aliphatic desulfoglucosinolate sulfotransferase [EC:2.8.2.38]
Organism
bna  Brassica napus (rape)
Pathway
bna00966  Glucosinolate biosynthesis
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106411693
Enzymes [BR:bna01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.38  aliphatic desulfoglucosinolate sulfotransferase
     106411693
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 PIK3CG_ABD
Other DBs
NCBI-GeneID: 106411693
NCBI-ProteinID: XP_013707952
LinkDB
Position
C6:44917931..44919157
AA seq 344 aa
MESEPLTGTTVPNQDKTETESSEFEKNQERYQTLISTFTHEKGWRPKEPFIEYGGHWWVQ
PLLEGCLHAQEFFQARPNDIFVCSYPKTGTTWLKALTFAIVNRSRFDDSSNPLLKRNPHE
FVPYIEIDFPFFPQVDVLNDKGNTLFSTHIPCESLPDSVVKSRCKLVYIWRDPKDTFISL
WTFLHKERSELGPVSKLEEAFDMFCRGLSGYGPYLDHVLGYWKAYQENPDKILFLKYEFM
RADPLPYVKRLAEFMGYGFTEEEEEKGVAEKVVDLCSFETLKNLEANKGEKEREDRAAVY
ANSAYFRKGKVGDWLNYLTPEMAARIDGIMEEKFKDTGLLEHGQ
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaatcagagcctttaaccggaacgaccgtaccgaaccaagacaagaccgaaacagag
tcatcagagttcgagaagaatcaagaacggtaccaaacactaatctccacgttcacacac
gagaaaggctggagaccaaaggaacccttcatcgagtacggtggtcactggtgggtacag
cctctcctcgaaggctgccttcacgcgcaagagttcttccaagctcgacccaacgacatc
ttcgtgtgtagctacccaaagacaggcaccacttggctcaaagctttgactttcgccatc
gtaaaccgatcacgcttcgacgattcctcgaaccctctcctcaaacgtaaccctcacgag
ttcgttccttacatcgagatcgacttccctttcttccctcaagtcgatgttctcaacgac
aaaggcaacactctgttctcaactcacatcccttgcgagtcattaccggattcagttgtg
aagtcacgttgtaagctggtttacatctggagagatccaaaggatactttcatctctcta
tggacgtttctacacaaagagaggtcagagcttggtcctgtaagcaaactcgaggaggct
tttgatatgttctgtcgaggtttgtctggttacggtccttatcttgatcatgtcttgggt
tactggaaagcttaccaagagaatccggataagatcttgttcctcaagtacgagtttatg
agagctgatcctttgccgtatgtgaagaggttggctgagtttatggggtatggattcacg
gaagaggaagaggagaagggtgttgctgagaaagtggtggatctttgcagcttcgagacg
ttgaagaatcttgaagctaacaaaggggagaaagagagggaagatcgtgctgctgtttac
gcgaatagcgcgtattttaggaaaggtaaggttggagattggttgaattatttgactcca
gagatggctgctcgtattgatgggataatggaagagaagttcaaggatacaggtttgctt
gaacatggtcaatga

DBGET integrated database retrieval system