Brassica napus (rape): 106449151 Help Entry 106449151         CDS       T04128                                  Name (RefSeq) putative thioredoxin H10   KO K03671   thioredoxin Organism bna  Brassica napus (rape) Brite KEGG Orthology (KO) [BR:bna00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bna03110]     106449151 Chaperones and folding catalysts [BR:bna03110]  Protein folding catalysts   Protein disulfide isomerase    106449151 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 PedC-like HyaE A6-like_Thioredoxin-like_C Motif Other DBs NCBI-GeneID:  106449151 NCBI-ProteinID:  XP_022556562 LinkDB All DBs Position C4:34039283..34039652 Genome browser AA seq 61 aa AA seqDB search MIFVTIDVEELAEFSDEWNVEATPTIVFLKDGRQMDKLVGAETSELQKKTAAAAELLLRK P NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgatttttgtaaccattgatgtggaagaactcgctgagtttagtgatgaatggaatgtg gaagctacaccaactatagtgtttcttaaagatgggagacaaatggataagcttgttggt gctgaaacctcagagcttcagaagaaaacagctgcagctgctgaactcttactcagaaaa ccataa

DBGET integrated database retrieval system