KEGG   Brassica napus (rape): 106451368
Entry
106451368         CDS       T04128                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00220  Arginine biosynthesis
bna00250  Alanine, aspartate and glutamate metabolism
bna00270  Cysteine and methionine metabolism
bna00330  Arginine and proline metabolism
bna00350  Tyrosine metabolism
bna00360  Phenylalanine metabolism
bna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bna00710  Carbon fixation by Calvin cycle
bna00950  Isoquinoline alkaloid biosynthesis
bna00960  Tropane, piperidine and pyridine alkaloid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
bna_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    106451368
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106451368
   00270 Cysteine and methionine metabolism
    106451368
   00220 Arginine biosynthesis
    106451368
   00330 Arginine and proline metabolism
    106451368
   00350 Tyrosine metabolism
    106451368
   00360 Phenylalanine metabolism
    106451368
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    106451368
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    106451368
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    106451368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106451368
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     106451368
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class I
   106451368
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 106451368
NCBI-ProteinID: XP_013748744
LinkDB
Position
A5:complement(7573410..7575870)
AA seq 430 aa
MAMMARTIRNSASRRTMMMSRPIFGLRSMSSWWKNVEPAPKDPILGVTEAFLADPSPDKV
NVGVGAYRDDNGKPVVLDCVREAERRIAGTSFMEYLPMGGSVKMVEETLKLAYGDNSEFI
KDKRIAAVQSLSGTGACRLFADFQTRFNPGSQIYIPVPTWSNHHNIWRDAQVPQKTYHYY
HPETKGLDFKGLMDDVKNAPEGSFFLLHACAHNPTGVDPTEEQWREISQLFKAKNHFAFF
DMAYQGFASGDPARDAKSIRIFLEDGHHIGISQSYAKNMGLYGQRVGCLSVLCENEKQAV
TVKSQLQQLARPMYSNPPLHGAQIVSTILGDPELKSLWLKEVKIMADRIIGMRTTLRESL
EKLGSPLSWEHVTKQIGMFCYSGLTPEQVDRLTSEYHIYMTRNGRISMAGVTTGNVGYLA
NAIHEVTKSS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggcgatgatggcgaggacaatccgtaactcggcttcacgtcgaacgatgatgatgagt
cgtcctatcttcggtttgcgaagtatgtcttcatggtggaagaacgtggagcctgctccc
aaagatccgatcctcggagtcaccgaggcttttctcgctgatcctagtcccgacaaagtt
aacgttggtgtgggagcatatcgtgatgataatgggaagcctgttgtcttggattgtgtt
agagaagctgaacgaagaattgctggcacctccttcatggagtaccttcctatgggaggg
agtgtgaaaatggtggaggaaactttgaagcttgcctatggggacaactctgaatttatc
aaagacaaacgaatcgctgcagttcagtctctctccggaactggtgcatgccgactcttt
gctgacttccagacacgtttcaatcccggttcacagatctacattcctgttccaacctgg
tccaaccaccacaacatctggagagatgcgcaagtccctcaaaagacttatcattactat
cacccagaaaccaagggtttagatttcaaaggattgatggatgatgtgaagaatgctccg
gaaggctcattcttccttcttcatgcctgtgctcataatcccactggagtcgaccctaca
gaggaacaatggagagagatctcacagctattcaaggccaaaaatcattttgcattcttc
gatatggcctatcaaggttttgccagtggtgatccagcaagagatgccaagtcaatcagg
atctttctcgaggatggtcatcatattggaatctctcagtcctatgccaaaaacatggga
ctctacggccagagagtcggatgtctcagcgtgctttgtgaaaatgaaaagcaagccgtg
actgtgaaaagtcagttgcagcaactagctaggccaatgtatagcaatccacctttacat
ggagctcaaatagtctcaactattctcggagacccagagttaaagagtctgtggctaaag
gaagtcaagatcatggctgatcggataattggcatgagaactactttgagggagagcctt
gagaagttaggatcgcctctatcatgggagcacgtaaccaagcagattggaatgttctgc
tacagtgggctgacaccagaacaggttgaccgcttaacaagcgaatatcacatctatatg
acccgtaatggccgtatcagtatggctggtgttacaacaggaaatgtgggataccttgcg
aatgctatacatgaagtcaccaagtcatcttaa

DBGET integrated database retrieval system