Brassica napus (rape): 11541983 Help Entry 11541983          CDS       T04128                                  Symbol psbE, BRNAC_p038 Name (RefSeq) photosystem II protein V   KO K02707   photosystem II cytochrome b559 subunit alpha Organism bna  Brassica napus (rape) Pathway bna00195   Photosynthesis bna01100   Metabolic pathways Module bna_M00161   Photosystem II bna_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:bna00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     11541983 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:bna00194]     11541983 (psbE) Photosynthesis proteins [BR:bna00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     11541983 (psbE) SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-GeneID:  11541983 NCBI-ProteinID:  YP_005089969 UniProt:  D1L8Q5 LinkDB All DBs Position Pltd:complement(62879..63130) Genome browser AA seq 83 aa AA seqDB search MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLDEFSRSF NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagcacaggagaacgttcttttgctgatattattaccagtattcgatactgg gtcattcatagcattactataccttccctattcattgcgggctggttattcgtcagcacc ggtttagcttacgatgtgtttgggagccctcgtccaaacgagtattttacagagagccga cagggcattccattaataacaggccgttttgattctttggaacaactcgacgaatttagt agatctttttag

DBGET integrated database retrieval system