Bacillus cereus NC7401: BCN_0126
Help
Entry
BCN_0126 CDS
T01686
Name
(GenBank) ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
bnc
Bacillus cereus NC7401
Pathway
bnc03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
bnc00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
BCN_0126
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
bnc03011
]
BCN_0126
Ribosome [BR:
bnc03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
BCN_0126
Bacteria
BCN_0126
Archaea
BCN_0126
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_S25
CheW
Motif
Other DBs
NCBI-ProteinID:
BAL15919
LinkDB
All DBs
Position
134226..134588
Genome browser
AA seq
120 aa
AA seq
DB search
MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVIDDVNGVTLVSASTLD
KDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHGRVKALAEAAREAGLQF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgatcactaaagctgataaaaatgcgactcgtaagaaaagacatgcgcgtgtacgtgct
aaacttactggtactgcagaacgtccacgtttaaacgtgttccgttctaaccaacatatt
tacgctcaagttattgatgatgtaaatggtgtaacgttagtaagtgcatctactcttgat
aaagaccttgctcttaacggtactagcaatattgaagctgctacgaaagttggagaatca
gttgctaagcgtgctgtagagaaaggcgttaaagaagtagtatttgatcgcggtggttac
ttataccatggccgtgttaaagctctagctgaagctgctcgtgaggctggattacaattt
taa
DBGET
integrated database retrieval system