Brevundimonas nasdae: KWG56_03770 Help Entry KWG56_03770       CDS       T07529                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bnd  Brevundimonas nasdae Pathway bnd01100   Metabolic pathways bnd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bnd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KWG56_03770    00074 Mycolic acid biosynthesis     KWG56_03770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KWG56_03770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QYC11136 LinkDB All DBs Position 763214..763453 Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDEKSAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgagcgcgttcgcaagatcgtcatcgaccacctggacgctgatccg gacaaggtcacggaaaaggccagcttcatcgacgacctgggcgctgactcgctcgacaac gtcgagctggtgatggccttcgaagaagaattcgacatcgaaatcccggatgacgctgca gagcacatccagacggtcggcgacgccgtcaagttcatcgacgagaagtcggcgggctga

DBGET integrated database retrieval system