KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00864
Entry
BALAC2494_00864   CDS       T01842                                 
Name
(GenBank) Hydrolase acting on acid anhydrides in phosphorous-containing anhydrides
  KO
K03655  ATP-dependent DNA helicase RecG [EC:5.6.2.4]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BALAC2494_00864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bnm03400]
    BALAC2494_00864
Enzymes [BR:bnm01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BALAC2494_00864
DNA repair and recombination proteins [BR:bnm03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BALAC2494_00864
SSDB
Motif
Pfam: Helicase_C DEAD ResIII RecG_dom3_C Flavi_DEAD DUF2075 AAA_30 SNF2-rel_dom TsaE Zot DUF3638 AAA_22
Other DBs
NCBI-ProteinID: AEK29717
UniProt: A0A806FG15
LinkDB
Position
313667..316144
AA seq 825 aa
MGTFSAPNMSLFTQGRGAGFAICGRGIDYDNKEAAMARQDGTRDVTLETPLHALLANKRR
VSALKKLGVLDVRDALTYYPFRVTDPVPVRALVQAQPGLKEKMACAVRVRSVRVSPMNAR
AGYRVEVLVDDDEFAATLHVRGSLATLVFFSHRKSYVDWLAGRLRVDGHVVIAGDPTMYM
DRLQFTHPELLTVGGANLRADVSTVAEGLQRVCRPRPVYHANSRISSEHIHDTILYVLRL
LAGEDPATAMHADDETAQPHMRTLYAENPQIREHLDAAIPDILPGNLLAELNLMHRAQAF
SQIHDPDSVGAFTQAITTMRYEEAFVCQTALIRARHDAREHNAYVCSDVQLRDEYIDTLP
FVLTKGQREVVDEISHDMCQDHPMQRLLQGEVGSGKTVVAVSAMLQAVGSGHQAVLVAPT
QVLAEQHYQSISNVFNRAPVLLLTGGMKLAERRKVLGTAASGEPCIVVATHAAFSKSFQA
PNLALAVIDEQHRFGVEQRETLRSKSDVDPHLLVMTATPIPRTAAMTWFGDLDISWLTEL
PGGRKPIQTVVIPEENAPLMAEMFWHIRHRIDAGERAYIVCPRIEESTEDAEGGESGGDA
RADSDDGMLLSDEDLGETNARAPLHSVHEISERLQSLPQFQGVRFCELTGRDDDETKERV
MAEFASGQTPVMVATTVIEVGVDVPQASCIVIFDADRYGLSQLHQLRGRVGRGGTHSWAF
LVSQAEPNSIAEQRLDVIAHSLDGALIAQKDLELRGAGDVLGDTQSGGRSSLKLLRVVKD
AAMITDARKRAELLLDADPTLEHHTQLAGAVLDFSRGNEKFLTSN
NT seq 2478 nt   +upstreamnt  +downstreamnt
ttggggacgtttagcgcacctaatatgtctctttttacgcagggaaggggcgcgggtttc
gcaatctgcgggcgtgggatagactatgacaacaaggaggcggcaatggcacggcaggac
ggtacgcgcgacgtgacgctcgagacgccgctgcacgctctgctcgccaacaaacgtcgc
gtgagcgcactgaagaagctcggcgtgctcgacgtgcgcgacgcgctcacgtattacccg
ttccgcgtcaccgatcccgtccccgtgcgcgcgctcgtgcaggcccagcccggtctcaag
gagaagatggcgtgcgccgtgcgcgtgcgcagcgtgcgtgtcagcccgatgaacgcgcgc
gccggctaccgtgtggaagtgctcgtcgacgacgacgagttcgccgcgacgctccatgtg
cgcggttcgctggccacgctcgtgttcttctcgcatcgcaaatcgtacgtggactggctc
gccggccgcttgcgcgtcgacggccacgtggtgattgccggggatccgaccatgtatatg
gaccgtctgcaattcacccaccccgaactgctcaccgtgggcggcgcgaatctgcgggcc
gatgtgagcacggtggccgagggtctgcagcgcgtctgccggccgcggcccgtctaccat
gcgaattcgcgcatctcgagcgagcatattcacgacacgatcctctatgtgttgcgtctg
ctcgccggcgaggacccggcgaccgcgatgcacgccgacgacgagaccgcgcagccgcac
atgcgcacgctgtatgcggaaaatccgcagattcgcgagcatttggatgccgcgatcccg
gacattctgccggggaatctgctggccgagctgaatctgatgcaccgcgcgcaggcattc
tcgcagattcacgacccggactcggtgggcgcgttcacgcaggcgatcacgacaatgcgc
tacgaggaggcgttcgtatgccagaccgcgctgatccgcgcccggcacgatgcgcgcgag
cacaacgcgtacgtgtgctccgacgtgcaactgcgcgacgaatacatagacacgctgccg
ttcgtactgacgaaaggccagcgggaggtcgtcgacgagatcagccacgacatgtgccag
gaccacccgatgcagcgcctgctgcaaggcgaagtgggctcgggcaagacggtggtggcg
gtgagcgcgatgctgcaggcggtcggatctgggcaccaggccgtgctcgtcgcgcccacg
caggtgctcgccgagcagcattaccaatcgatctcgaacgtgttcaaccgcgcgcccgtg
ctgctgctcaccggcggcatgaagctcgccgagcgacgcaaagtgctcggcacggcggca
agcggggagccgtgcatcgtcgtggccacgcacgccgcgttctcgaagtcgttccaggca
ccgaacctcgcgctcgcggtgatcgacgagcagcaccgcttcggcgtggaacagcgtgaa
acactgcgttcgaagtcggacgtggacccgcatctgctggtgatgacggcgacgccgatt
ccgcgcacggcggcgatgacctggttcggcgacctcgacatctcctggctcaccgagttg
ccgggcgggcgcaagccgatccagaccgtggtgattcccgaagagaacgcgccgctcatg
gccgagatgttctggcatattcgccaccgcatagacgccggcgagcgcgcatacattgtg
tgcccgcgcatcgaggagtcgactgaagacgccgagggcggggaaagcggcggcgatgcg
cgcgccgattccgacgacggcatgctgctcagcgacgaggacctcggcgagacgaacgca
cgtgcgccgctacattcagtgcatgagatctccgagcgcctgcaatcgctgccacagttc
caaggcgtgcgattctgcgaactgaccggccgcgacgacgacgagacgaaggagcgcgtg
atggccgaattcgccagcgggcagacgccggtcatggtggcgaccacagtaatcgaggtg
ggcgtggacgtgccacaggcgagctgcatcgtgatcttcgacgccgacaggtacgggctc
tcccagctgcatcagctgcgcgggcgcgttggccgtggcggcacgcacagctgggcgttc
ctggtgtcgcaggctgagccgaacagcattgccgagcagcggctcgacgtgatcgcgcat
tcgctcgacggcgcgttgattgcgcaaaaagacctcgaattgcgcggtgccggcgatgtg
ctcggcgatacacagtcgggcggccgctcgagcctgaaactgctgcgcgtggtcaaggat
gccgccatgatcaccgatgcgcgcaagcgggccgagctgttgctggatgccgacccgacg
ctcgagcaccatacgcagctcgcgggcgcggtgctcgatttctcgcgcggcaacgagaag
ttcctcaccagcaactag

DBGET integrated database retrieval system