KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00928
Entry
BALAC2494_00928   CDS       T01842                                 
Name
(GenBank) Hydrolase acting on acid anhydrides in phosphorous-containing anhydrides
  KO
K02314  replicative DNA helicase [EC:5.6.2.3]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Pathway
bnm03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BALAC2494_00928
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bnm03032]
    BALAC2494_00928
Enzymes [BR:bnm01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     BALAC2494_00928
DNA replication proteins [BR:bnm03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BALAC2494_00928
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase TniB Rad51 AAA_24 MMR_HSR1 AAA_22
Other DBs
NCBI-ProteinID: AEK29643
UniProt: A0A806FHR2
LinkDB
Position
226288..227667
AA seq 459 aa
MADGFHNNTRTDTSANAAGLFDRVPPHDDNAEMATLGGMLMSKDAIGEVSQIVSVDDFYE
PKHQTIYEAIIGKFSASEPADAVTVANRLSDSGDLDKVGGIDYLHSLIASVPTAANASYY
AEIVHQRALLRRVIASGTKIAQLGYDAEGSQAQDVINMAQAEVYEMSTGRVRQDYAPVQA
AVHDALDQIDSIQKGELQAGVPTGFQEIDEVTKGLQPGQMVVVAGRPAMGKSTLGVDFAR
SAAIHHHDTTILFSLEMSKVELAQRIISAETGVPLAALRNADDIDPNRWNTLNNFYARLQ
DAPLFIDDSPNMSLMEIRAKCRRLKQTNDLKLVVIDYLQLMTSGKAVESRQQEVSEFSRA
LKLLAKELEVPVVALSQLNRGPEMRNDKKPQLSDLRESGSIEQDADVVFLVHRPDFYDEE
DRPGEADIIMAKHRNGPTRTFGLVFQGQYSRFSDMNREV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggctgacggattccacaacaacactcgcaccgacaccagcgccaatgccgctggtctc
ttcgaccgcgtccccccgcacgacgacaacgccgagatggcgacgcttggcggtatgctc
atgagcaaggacgccattggcgaggtttcgcagatcgtttcggtggatgacttctatgag
ccgaagcaccagacgatctacgaggcgatcattggcaagttctccgcatccgagcccgcg
gacgccgtcaccgtggccaacaggctgagcgactccggagacctcgacaaggtcggtggc
atcgactacctgcattcgctcatcgcctccgtgcccacggctgcgaacgcctcgtattat
gcggagattgtgcaccagcgcgcgctgttgcgccgcgtgatcgcctcgggtacaaagatc
gcgcagctcggctatgacgccgaaggctcgcaggcgcaggatgtgatcaacatggcgcag
gccgaggtgtacgagatgagcaccggccgcgtgcgccaggactacgcccccgtgcaggcc
gccgtgcacgatgcgctcgaccagatcgacagcattcagaaaggtgagctccaggcgggc
gtgcccaccggcttccaggagatcgacgaggtgaccaagggcctgcagccgggccagatg
gtggtggtcgccggccgcccggccatgggcaagtccacgctcggtgtggatttcgcgcgc
tccgccgccattcaccaccacgacacgaccattctgttcagcttggaaatgagcaaggtc
gaacttgcgcagcgcatcatctcggcggagacgggcgtgccgctggccgccttgcgcaat
gccgacgacattgacccgaaccgctggaacacgctcaacaacttctatgcgaggcttcag
gacgccccgctgttcatagacgattcgccgaacatgagcctcatggagatccgcgcgaaa
tgccgccggctcaagcagacgaacgacctcaagctcgtcgtgatcgactacctgcagctc
atgacctcgggcaaggccgtggaaagccgccagcaggaggtctccgagttctcgcgagca
ctcaagctgcttgccaaggagctcgaggtgccggtggtggcgttgagccagctcaaccgt
ggcccggaaatgcgcaacgacaagaaaccgcagctttccgacctgcgcgaatccggctcc
atcgagcaggacgccgacgtggtgttcctcgtgcaccgcccggacttctacgacgaagag
gaccgcccgggcgaggctgacatcatcatggccaagcaccgcaacggcccgacgcgcacc
ttcggcctggtgttccaaggccagtactcacgcttcagcgacatgaaccgcgaggtgtga

DBGET integrated database retrieval system