Brettanomyces nanus: FOA43_003395 Help Entry FOA43_003395      CDS       T07002                                  Symbol TFB5 Name (RefSeq) TFIIH complex subunit tfb5   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism bnn  Brettanomyces nanus Pathway bnn03022   Basal transcription factors bnn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bnn00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     FOA43_003395 (TFB5)   09124 Replication and repair    03420 Nucleotide excision repair     FOA43_003395 (TFB5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bnn03021]     FOA43_003395 (TFB5)    03400 DNA repair and recombination proteins [BR:bnn03400]     FOA43_003395 (TFB5) Transcription machinery [BR:bnn03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      FOA43_003395 (TFB5) DNA repair and recombination proteins [BR:bnn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      FOA43_003395 (TFB5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  62196795 NCBI-ProteinID:  XP_038779574 UniProt:  A0A875S8K4 LinkDB All DBs Position 4:complement(386797..387012) Genome browser AA seq 71 aa AA seqDB search MARAIKGSLVECDPSIKALIVKIDSDYRDIVIEELDDTHLLVDPSKIPFIKRELSKLLSE NMYNLNEDNQA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggcaagagctattaaaggtagtttagttgaatgcgatccttctatcaaagcattgatc gtgaagattgattcggattatagagacatagtcattgaagaattggacgatacccactta ctagtggatccatccaagattccattcattaagcgagaactcagtaagctattgtcggaa aatatgtacaacctcaacgaagacaatcaagcttaa

DBGET integrated database retrieval system