KEGG   Brettanomyces nanus: FOA43_004584
Entry
FOA43_004584      CDS       T07002                                 
Name
(RefSeq) uncharacterized protein
  KO
K12575  kinetochore protein SLK19
Organism
bnn  Brettanomyces nanus
Pathway
bnn04111  Cell cycle - yeast
bnn04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:bnn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    FOA43_004584
   04113 Meiosis - yeast
    FOA43_004584
SSDB
Motif
Pfam: Fungal_TACC DUF6586
Other DBs
NCBI-GeneID: 62197984
NCBI-ProteinID: XP_038780743
LinkDB
Position
4:2824658..2826787
AA seq 709 aa
MGEKLVNETPATTSTTSTDSIDYRTIPHGLTYKHEARHSSNRRYSMSPKRISTTIEVKRH
PLTCIKDTNHKKLDIVGAKHDLTADLVTLDKENGKKPGNSDADADADADADAGADVDADA
EGAFFDASPQKLVSAALPNLNNDDDVESSPVNSHQTRKKRVSASVDTIAKRQRLEEQSNN
YHTPVRRDSDENGGKKTTPRRAHHRRIIDESKMNLEGNINDNNDDHSVLDPENSPLANVS
QGSIVDQDIDGETEVFQQLKHFNNKNSIRDIGSLDDKSSIEQSEDDDSYDSNLRMSPVRI
DNNMLSPLARIRTEAESIEQDKELQDLEQEQEDLEHRQQYEKAIFTPAQVQAMKRSLEEH
IRSLDQALDMKSKSLKDLGLELNNTREKHNELKDRIEKLGRERDHYKALMESSKNHADSA
LEVASSADKKYSISGLKLRICESKLEKYKGLYTELMRTAKNLQEKLTEESEIREKLSEQT
DKLEKELEKCKLLQHELQSSLELKQAEVKSLVEEKSENEVMIKNLKSINDETDSQLKKLH
VQFNTSKEKLEKARKETEDQSLELEKAKKKVNSLRTRLSSAETEVQAKQRNESDDLTKLK
NQLSTVQQELSVAQKKIGNNENNLEEQLEKLAQDLYLQYSAKHEQKVATLKKGYEMKWMG
KVKKFTKDNEALKRDITALKKKLEIETNEKKQLVKLWDEYVNLEKKGKV
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgggtgagaaactcgttaatgaaacaccagccacaacttctactacttccacagactca
atcgattatcgtacgattccccatggcttgacctataaacatgaagcacgtcattcgtca
aataggaggtactcgatgtctcctaagcgcatttccactactattgaggtcaaaagacat
cctctcacttgtattaaggacaccaatcacaagaagctggatattgttggtgccaaacac
gacttgactgctgatttggttactcttgacaaggagaacggtaaaaaaccgggtaattct
gatgccgatgccgatgccgatgccgatgccgatgctggtgctgacgttgacgctgacgcc
gagggagccttttttgacgcgtcaccgcaaaaacttgtctctgcagcacttcctaacctg
aacaatgatgatgacgttgaatcttctcccgtgaacagtcatcaaacacgtaaaaagcgt
gtttctgcgtcggtcgatacgatcgcaaagagacagcggctagaagagcaatctaataat
tatcacactcctgtcagaagagactctgacgagaatggtggcaagaagacaaccccacga
agggctcatcaccgcagaataattgacgagtctaagatgaatttagaaggaaacatcaac
gataacaacgacgatcattctgtcttggatcccgaaaatagtccccttgccaatgtcagc
cagggaagtattgtggaccaggacatcgatggagaaacagaggtgtttcagcagctgaag
cattttaacaataagaatagcatacgtgatattggttcgttggatgataaatcatcgatc
gagcaaagcgaagatgatgatagctatgatagtaatcttcgaatgtcacctgttaggatt
gacaataatatgctatcaccgttagcacgaattcggacggaagcggagtctatagaacag
gacaaggagctgcaggatctcgagcaggaacaggaagatttggaacaccggcagcaatat
gagaaggccatatttacaccagcgcaagttcaggcgatgaagcgaagccttgaagaacat
atccgttctttggaccaggcattggacatgaaatcaaaaagcctgaaagatctcggcttg
gaattgaacaataccagagaaaagcataatgaattgaaagataggattgagaaacttggg
cgagaaagagatcattacaaagctttaatggaaagtagtaaaaatcatgcggattcagct
ttagaggttgcttctagtgccgacaagaaatacagtataagtggcctcaagcttcggata
tgtgagtcgaaattggagaaatacaaggggctctacacggaactgatgcggacggcgaag
aatttgcaagaaaagttgacggaagagtctgagataagggagaagctttctgaacagacg
gataagcttgaaaaagagctcgagaaatgtaaattgttacagcacgagcttcaatcgtca
ttagaactcaagcaggcagaagttaagagtctcgttgaggagaagtcggaaaacgaggtg
atgataaagaatctcaagagcattaacgatgagacggattcgcaattaaagaagttgcat
gttcagtttaatactagtaaggagaaattagagaaggccaggaaggaaactgaagatcaa
agtttggaattggagaaggccaaaaagaaagttaatagtttgagaacgaggctttcctct
gcagagactgaagtgcaagcgaaacagaggaatgagagcgacgatctgacgaaattaaag
aaccaacttagtacggtccaacaagaattgagtgtagcccagaagaagatcggaaacaac
gagaacaatttggaagagcaactggaaaagctggcacaagatttgtacctgcagtactct
gccaaacacgagcaaaaagtggctacgttgaagaaaggatacgagatgaagtggatgggt
aaggtgaagaagttcaccaaggacaatgaagcacttaaaagagatattactgcgcttaaa
aagaagcttgagatagagactaacgagaagaagcaattggtgaaactctgggacgaatat
gtgaatttagagaagaaaggaaaggtataa

DBGET integrated database retrieval system