Bacillus nitratireducens: GSN03_18180 Help Entry GSN03_18180       CDS       T07605                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bnt  Bacillus nitratireducens Pathway bnt01100   Metabolic pathways bnt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bnt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GSN03_18180 (acpP)    00074 Mycolic acid biosynthesis     GSN03_18180 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GSN03_18180 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  QUG85262 LinkDB All DBs Position complement(3609519..3609752) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgtgtaacaaaaatcatcgttgatcgtttaggtgtagaagaa actgaagtagtaccagctgcgagctttaaagaagatttaggcgcagactccctagatgta gtagaacttgtaatgcaattggaagatgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system