Candidatus Bandiella numerosa: N3Z17_00675 Help Entry N3Z17_00675       CDS       T09014                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bnu  Candidatus Bandiella numerosa Brite KEGG Orthology (KO) [BR:bnu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bnu03032]     N3Z17_00675    03036 Chromosome and associated proteins [BR:bnu03036]     N3Z17_00675    03400 DNA repair and recombination proteins [BR:bnu03400]     N3Z17_00675 DNA replication proteins [BR:bnu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     N3Z17_00675 Chromosome and associated proteins [BR:bnu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     N3Z17_00675 DNA repair and recombination proteins [BR:bnu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       N3Z17_00675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG ENT HTH_10 WD40_RFWD3 Motif Other DBs NCBI-ProteinID:  WHA05063 LinkDB All DBs Position complement(148841..149116) Genome browser AA seq 91 aa AA seqDB search MNKAEFIEKLSKELDISKAEAGRHLDKIFKCIATSMKDNDELRFTGFGSFKAKRTEAKEV KTPKGTMAKVPAQRRISFSVGSDFKAIVNEK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaataaagcagaatttatagaaaagctgtcaaaagaactagatataagtaaagcagaa gctggtaggcatttagacaaaatatttaaatgtatagctacatctatgaaggataatgat gaattaagattcacaggatttggaagttttaaagcaaaacgaacagaggcaaaggaagta aagacaccaaaagggacaatggctaaagttcctgcacaaaggagaataagtttctcagtt gggtctgattttaaagctattgtgaatgagaagtag

DBGET integrated database retrieval system