Bombella sp. ESL0368: GN304_04710 Help Entry GN304_04710       CDS       T06372                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bob  Bombella sp. ESL0368 Pathway bob01100   Metabolic pathways bob01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bob00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GN304_04710    00074 Mycolic acid biosynthesis     GN304_04710   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GN304_04710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Sas6_CC Motif Other DBs NCBI-ProteinID:  QGT75116 LinkDB All DBs Position 1075778..1076032 Genome browser AA seq 84 aa AA seqDB search MTDSVADISHMILQKLLENPKVPRDISEDSRIVEDLAFDSLAVMNFVMEIEDMLDVSVPL DKLADIRTIKDLASCLHTIKAEQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacagacagtgttgctgatatctctcacatgattctccagaaacttctggaaaacccg aaagtgccacgcgacatttccgaagacagtcggatcgtggaagacttggccttcgacagt ctcgccgtcatgaattttgtgatggagattgaggatatgcttgatgtctccgtccctctc gacaagcttgcagacatccgtaccatcaaagatctcgcttcctgtctgcataccatcaag gcagaacaggcatga

DBGET integrated database retrieval system