Bombella sp. ESL0368: GN304_05355 Help Entry GN304_05355       CDS       T06372                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism bob  Bombella sp. ESL0368 Brite KEGG Orthology (KO) [BR:bob00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bob03032]     GN304_05355    03036 Chromosome and associated proteins [BR:bob03036]     GN304_05355    03400 DNA repair and recombination proteins [BR:bob03400]     GN304_05355 DNA replication proteins [BR:bob03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GN304_05355 Chromosome and associated proteins [BR:bob03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GN304_05355 DNA repair and recombination proteins [BR:bob03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GN304_05355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Urease_beta DUF2267 PCuAC HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QGT75218 LinkDB All DBs Position complement(1214706..1214993) Genome browser AA seq 95 aa AA seqDB search MEKPLNKQELIASVAEAADLPKAKAGDVVDAVFGTIEKTLAKGQEVRLVGFGSFVTATRK AAKGRNPRTGEEIDIPASTSVRFKPGKGLKDAVSK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggagaaacctctgaacaagcaggaactcattgcttccgttgccgaggctgctgatctt cccaaggcgaaggctggtgatgtcgtggatgccgtgttcggcaccatcgagaagaccctg gccaaggggcaggaagttcgcctggtaggctttggcagcttcgtgacagccacccgcaag gctgccaagggccgcaacccgcgtacgggtgaagagatcgacattccggcttccacgtcc gtgcgtttcaagccgggcaagggcctgaaggatgccgtcagcaagtaa

DBGET integrated database retrieval system