Burkholderia oklahomensis C6786: BG90_4210
Help
Entry
BG90_4210 CDS
T03861
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter, ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
boc
Burkholderia oklahomensis C6786
Pathway
boc02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
boc00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
BG90_4210 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
boc02000
]
BG90_4210 (phnC)
Enzymes [BR:
boc01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
BG90_4210 (phnC)
Transporters [BR:
boc02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
BG90_4210 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
SbcC_Walker_B
AAA_22
AAA_27
AAA_23
RsgA_GTPase
AAA_29
NACHT
Motif
Other DBs
NCBI-ProteinID:
AJX35035
LinkDB
All DBs
Position
II:complement(685679..686530)
Genome browser
AA seq
283 aa
AA seq
DB search
MNMPIGTPHVGAIGRAPISFTPVSAMPPRVVAGGETKLAVHGLSMRYPNGHVALRGLDLS
VRAGEFVVMLGSNGCGKSTFLKCVVGLNRPTSGTIEVAGRNLAGLSGEMLRVARLPIALI
SQHANLVKRRSVLANVCTGALGRYRTWETAFGRVPRAEVQPSLGFLDEVGLPHLARQRAS
TLSGGQAQRVAVARALAQRPQVLLADEPLASLDPEAAEEVMRLLRRLASEDGIAVVCVLH
QPGLAQRYADRLIGLRQGAVVFDDAAAAVDPATMTHLYASEPQ
NT seq
852 nt
NT seq
+upstream
nt +downstream
nt
atgaacatgcccatcggaacgcctcacgtcggtgcgatcggacgcgcgccgatatcgttc
acgcccgtttccgcgatgccgccgcgcgtcgtggccggcggcgagacgaaactcgcggtg
cacggcctgtcgatgcgctatccgaacggacacgtcgcgctgcgcgggctcgatctgtcg
gttcgcgcgggcgaattcgtcgtgatgctcggcagcaacggctgcggcaagtcgacgttc
ctgaagtgcgtggtcggcctcaaccggccgaccagcggcacgatcgaagtcgccggccgc
aatctcgccggcctctccggcgagatgctgcgcgtggcgagactgccgatcgcgctgatc
tcgcagcacgcgaacctcgtgaagcgccgcagcgtgctcgccaacgtgtgcaccggcgcg
ctcggccgctaccgcacgtgggaaaccgcgttcggccgcgtgccgcgcgccgaagtgcag
ccgtcgctgggcttcctcgacgaagtcggcctgccgcacctcgcccggcagcgcgcaagc
acgctgtcgggcggccaggcgcagcgggtcgcggtggcccgcgcgctcgcgcagcggccg
caagtgctgctcgccgacgagccgctcgcgagcctcgaccccgaggccgccgaggaagtc
atgcggctgctgcgccggctggcgtccgaggacggcatcgcggtcgtctgcgtgctgcat
cagccggggctcgcgcaacgctatgcggatcgattgatcggcctgcgccagggcgcggtc
gtattcgacgacgcggccgcggccgtggatccggcgacgatgactcatctctacgcatcg
gaaccgcaatga
DBGET
integrated database retrieval system