KEGG   Burkholderia oklahomensis C6786: BG90_4210
Entry
BG90_4210         CDS       T03861                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter, ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:boc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BG90_4210 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boc02000]
    BG90_4210 (phnC)
Enzymes [BR:boc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     BG90_4210 (phnC)
Transporters [BR:boc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    BG90_4210 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcC_Walker_B AAA_22 AAA_27 AAA_23 RsgA_GTPase AAA_29 NACHT
Other DBs
NCBI-ProteinID: AJX35035
LinkDB
Position
II:complement(685679..686530)
AA seq 283 aa
MNMPIGTPHVGAIGRAPISFTPVSAMPPRVVAGGETKLAVHGLSMRYPNGHVALRGLDLS
VRAGEFVVMLGSNGCGKSTFLKCVVGLNRPTSGTIEVAGRNLAGLSGEMLRVARLPIALI
SQHANLVKRRSVLANVCTGALGRYRTWETAFGRVPRAEVQPSLGFLDEVGLPHLARQRAS
TLSGGQAQRVAVARALAQRPQVLLADEPLASLDPEAAEEVMRLLRRLASEDGIAVVCVLH
QPGLAQRYADRLIGLRQGAVVFDDAAAAVDPATMTHLYASEPQ
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaacatgcccatcggaacgcctcacgtcggtgcgatcggacgcgcgccgatatcgttc
acgcccgtttccgcgatgccgccgcgcgtcgtggccggcggcgagacgaaactcgcggtg
cacggcctgtcgatgcgctatccgaacggacacgtcgcgctgcgcgggctcgatctgtcg
gttcgcgcgggcgaattcgtcgtgatgctcggcagcaacggctgcggcaagtcgacgttc
ctgaagtgcgtggtcggcctcaaccggccgaccagcggcacgatcgaagtcgccggccgc
aatctcgccggcctctccggcgagatgctgcgcgtggcgagactgccgatcgcgctgatc
tcgcagcacgcgaacctcgtgaagcgccgcagcgtgctcgccaacgtgtgcaccggcgcg
ctcggccgctaccgcacgtgggaaaccgcgttcggccgcgtgccgcgcgccgaagtgcag
ccgtcgctgggcttcctcgacgaagtcggcctgccgcacctcgcccggcagcgcgcaagc
acgctgtcgggcggccaggcgcagcgggtcgcggtggcccgcgcgctcgcgcagcggccg
caagtgctgctcgccgacgagccgctcgcgagcctcgaccccgaggccgccgaggaagtc
atgcggctgctgcgccggctggcgtccgaggacggcatcgcggtcgtctgcgtgctgcat
cagccggggctcgcgcaacgctatgcggatcgattgatcggcctgcgccagggcgcggtc
gtattcgacgacgcggccgcggccgtggatccggcgacgatgactcatctctacgcatcg
gaaccgcaatga

DBGET integrated database retrieval system