KEGG   Burkholderia oklahomensis C6786: BG90_4934
Entry
BG90_4934         CDS       T03861                                 
Name
(GenBank) taurine catabolism dioxygenase TauD, TfdA family protein
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00430  Taurine and hypotaurine metabolism
boc00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BG90_4934
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BG90_4934
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     BG90_4934
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AJX34613
LinkDB
Position
II:complement(1539558..1540394)
AA seq 278 aa
MTRLKLTRLTPAIGAIVDNADLANAVDDDVRSAIRDALARHQVLFFRDQRLSAVQHRDFA
AGFGDLHVHPIYPSHPDAREIMVLDNEVFDLKDNAIWHTDVTFAETPPCASILAACTLPD
TGGDTLWGSGFAAYDALSDRVKTQLEGLTAQHDFTKSFPLKRFGLTADDRARWEETRIKH
PPVTHPVVRTHPESGRRALFVNDGFTTEINELPEEESAALLRFLFAHQSRPEFTLRWRWQ
AGDVAFWDNRSTIHYAVNDYGNAHRVMHRATIVGDKPY
NT seq 837 nt   +upstreamnt  +downstreamnt
atgactcgactgaaactgacccgactgacgcccgcgatcggcgcgatcgtcgacaacgcg
gaccttgcgaatgcggtcgacgacgacgttcgcagcgcaatccgcgacgcgctcgcgcgc
catcaggtgctgttcttccgcgatcagcgcctgagcgccgtccagcatcgcgacttcgcg
gccgggttcggcgatctgcacgttcacccgatctatccgtcgcatccggatgcgcgcgag
atcatggtgctcgacaacgaagtcttcgatctgaaggacaacgcgatctggcatacggac
gtgacgttcgccgagacgccgccgtgcgcgtcgatcctcgccgcgtgcacgctgcccgat
acgggcggcgacacgctgtggggcagcggcttcgccgcgtacgatgcgttgtccgatcgc
gtgaagacgcagctcgagggcctcaccgcgcagcacgatttcacgaagtcgtttccgctg
aagcgcttcgggctcacggccgacgatcgcgcacgctgggaagaaacgcgcatcaagcat
ccgcccgtcacgcaccctgtcgtgcgcacgcatccggaaagcgggcgccgcgcgctgttc
gtcaacgacggcttcacgaccgagatcaacgagctgcctgaagaagaaagcgccgcgttg
ctgcgcttcctgttcgcgcatcagtcgcggccggagttcacgctgcgctggcgctggcag
gccggcgacgtcgcattctgggataaccgctcgacgattcactacgcggtgaacgactac
ggcaacgcgcatcgggtgatgcatcgcgcgacgatcgtcggcgacaagccgtattga

DBGET integrated database retrieval system