Bactrocera oleae (olive fruit fly): 106614841 Help Entry 106614841         CDS       T07646                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04814   Motor proteins Brite KEGG Orthology (KO) [BR:bod00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     106614841  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bod03037]     106614841    04812 Cytoskeleton proteins [BR:bod04812]     106614841 Cilium and associated proteins [BR:bod03037]  Motile cilia and associated proteins   Dynein arm    106614841 Cytoskeleton proteins [BR:bod04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      106614841 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF6547 Fascin Motif Other DBs NCBI-GeneID:  106614841 NCBI-ProteinID:  XP_014086233 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MDEARDESQFIVDDVSKIIKDAIENTIGGNAYQHDKVNNWTGQVVENCLSVLTKEQKPYK YIVTSMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgaagcgcgtgatgaaagccaatttattgtggacgacgtaagcaaaataattaag gatgccattgagaacaccatcggcggcaacgcctaccaacatgacaaggtaaacaactgg acgggacaagttgtggagaactgtcttagtgttcttaccaaggagcagaaaccatataaa tacattgtcacgtcgatgataatgcaaaagaatggcgctggtctgcatacagccagttca tgctattggaataatgacacagatggaagctgcacagtgcgttgggaaaataaaacgatg tattgtattgtgtcggtgtttggtctagccgtttaa

DBGET integrated database retrieval system