KEGG   Bactrocera oleae (olive fruit fly): 106615755
Entry
106615755         CDS       T07646                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bod  Bactrocera oleae (olive fruit fly)
Pathway
bod00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bod00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106615755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bod00199]
    106615755
Enzymes [BR:bod01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106615755
Cytochrome P450 [BR:bod00199]
 Cytochrome P450, animal type
  CYP306 family
   106615755
SSDB
Motif
Pfam: p450 DUF4080
Other DBs
NCBI-GeneID: 106615755
NCBI-ProteinID: XP_014087562
LinkDB
Position
Unknown
AA seq 545 aa
MLAILESDKMFTYYTALFGLIALLVIISEVLRAWRSRKYPRGPWGLPILGYLPFLNKREP
YKTLTELAKRYGPVYSLRLGNVNVVVLADAASVREFLKCEEFTARAPLYVTHGIMGGFGL
ICSEGALWRNQRKHVIDWLKDLGMTKKQGNARKSMEQRIKSGVIECMKSFRDDSKKHSSF
DPHHALQHTLGNIINDLVFGVKYARDDVTWKYLLQLQEKGLKLMGVSGAVNFLPWLRFLP
WNMRSIRFLLDGKARTHEIYNSLIEKREKSWEQRKAVSDENFNILDHFIDERMRREDSDI
AEERLSTDIYYTQDQLLHLLADMFGAGLDTTLATMRWFLLYMCKYQEVQEQLRTELLNIP
DSDFDLEHLEKCHFLRACISETQRIRSVVPLGIPHGAVEDFTIQGYLIPKNCMIIPLQWS
AHMSRLKWIEPELYWPGRFLDDNDEYCQPADFIPFQTGKRICPGEELARMMLFLYAGYII
RSFYIRLSQEHECMSVRGENGITLVPKYYEIVATPMRNMKDLVKDDDVGMYKAVAVKKDI
KSNTI
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgttggcgattttggagtcggacaaaatgtttacatattacacggcgctgtttggacta
atcgcgctattagtcatcatcagcgaggtgttgcgcgcatggcgttcacgaaagtatccg
cgcggaccctggggtctgcccatacttggctatttgccatttctcaataagcgcgaacca
tacaaaacattaacggaattagcgaagagatacggcccggtctattcgctgcggctgggc
aatgtgaatgtggtggtgttggccgatgcagcgtcggtgcgggaatttttaaagtgtgag
gaattcactgcgcgcgcaccgctctatgtaacgcacggcataatgggcggattcggtctc
atctgctcggaaggtgcgctgtggcgcaaccaacgcaagcacgtcatcgactggctgaaa
gatctgggtatgacaaaaaaacaaggcaacgcgcgtaaatcaatggagcagagaataaaa
agcggtgttatagaatgcatgaagtctttcagagacgattccaagaagcattcgtctttc
gatccacaccacgcgctgcagcacacattgggcaacatcatcaacgacttggtgtttggc
gtgaaatacgcgcgcgatgacgtcacctggaaatatttgctgcagctgcaggagaagggt
cttaaattgatgggcgtctcaggtgcagtgaatttcctgccttggctgagattcctgccc
tggaatatgcgttccatacgcttcctactcgacggcaaggcgcgcacacatgaaatttac
aacagcctgattgagaagcgtgaaaagtcgtgggaacaacgtaaagcggtaagcgacgag
aacttcaatatattggatcatttcattgatgagcgcatgcgtcgtgaggattccgatatt
gccgaagagcgtctgtccactgacatctactacacgcaggatcagttgctgcatctgctc
gcggatatgtttggtgcgggactggacaccactttggcgacaatgcgctggtttttactc
tacatgtgcaagtaccaggaggtgcaggagcagctcagaacggaacttttgaacataccc
gatagcgattttgacttggaacatttggagaagtgtcactttttgcgcgcttgcatctcg
gaaacacagcgcatacgctcggtggtgcctctgggtataccacatggcgctgtggaggat
tttaccattcaaggctatttaatacctaagaattgcatgatcattccactacagtggtct
gcgcatatgagtcgcctcaagtggatcgaaccggaattgtattggcccggccggtttttg
gatgacaatgacgaatactgccagcctgcggattttataccatttcagacgggcaaacgc
atatgccccggcgaggagctcgctcgcatgatgctcttcctttacgccggttacataata
cgcagtttctacattcgtttgtcgcaggagcacgaatgcatgagtgtgcgtggtgaaaac
ggcataacattagtgccgaaatattatgaaatcgtagcgacacccatgcgcaacatgaag
gatctagttaaggacgacgacgtgggcatgtacaaagctgtagcggtgaagaaggacata
aaatcaaacacaatttaa

DBGET integrated database retrieval system