Bactrocera oleae (olive fruit fly): 106616137 Help Entry 106616137         CDS       T07646                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04137   Mitophagy - animal bod04140   Autophagy - animal bod04144   Endocytosis bod04145   Phagosome bod04148   Efferocytosis Brite KEGG Orthology (KO) [BR:bod00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106616137    04145 Phagosome     106616137    04140 Autophagy - animal     106616137    04137 Mitophagy - animal     106616137    04148 Efferocytosis     106616137  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bod04131]     106616137   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bod04147]     106616137    04031 GTP-binding proteins [BR:bod04031]     106616137 Membrane trafficking [BR:bod04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106616137 Exosome [BR:bod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106616137   Exosomal proteins of other body fluids (saliva and urine)    106616137   Exosomal proteins of colorectal cancer cells    106616137   Exosomal proteins of bladder cancer cells    106616137 GTP-binding proteins [BR:bod04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106616137 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase SRPRB AAA_16 nSTAND3 Septin AAA_24 ATPase_2 MoeA_N Motif Other DBs NCBI-GeneID:  106616137 NCBI-ProteinID:  XP_014088114 UniProt:  E5L9W4 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATRKKSLLKVIILGDSSVGKTSLMNQYINKRFSNQYKATIGADFCTKEVIADDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNSFKNLDSWRDEFLIQASPRDPDHFPF VVLGNKVDMDNRQVSTRRAQQWCQSKNDMPYFETSAKDGTNVELAFQTIARNALAQEAEV ELYNEFPDQIRLNTDRNNRNGNSDNCQC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaacgcgcaagaagtctttgctgaaagtgatcattctaggagatagtagcgttgga aaaacgtcactcatgaatcaatatataaataaacgattctctaatcagtacaaggcaacg atcggagctgatttctgtacaaaggaagtcattgctgacgaccgagtagtcacaatgcaa atttgggacactgctggacaggaacgctttcaatctctgggggttgccttttaccgtggc gctgattgttgtgtacttgtatacgacgtcacttcaccaaattcatttaaaaatctggat tcatggcgtgatgagtttttgatacaggcgagtccaagagatccagatcactttcctttc gtggtgctcggaaataaagttgacatggataatcggcaggtatctacaaggcgagctcaa cagtggtgtcaatctaaaaatgatatgccatactttgaaacttcagcgaaagacggcaca aatgtagaattggcattccaaactattgctagaaatgcgcttgctcaggaagccgaggtt gaactatacaatgaatttcctgatcaaatccgccttaacacagatcgtaacaatcgcaat ggcaattctgataactgtcagtgctaa

DBGET integrated database retrieval system