Bactrocera oleae (olive fruit fly): 106617598 Help Entry 106617598         CDS       T07646                                  Name (RefSeq) probable insulin-like peptide 1   KO K04526   insulin Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04068   FoxO signaling pathway bod04081   Hormone signaling bod04140   Autophagy - animal bod04150   mTOR signaling pathway bod04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bod00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106617598    04150 mTOR signaling pathway     106617598   09133 Signaling molecules and interaction    04081 Hormone signaling     106617598  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106617598  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     106617598  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bod04052]     106617598 Cytokines and neuropeptides [BR:bod04052]  Neuropeptides   Unclassified    106617598 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  106617598 NCBI-ProteinID:  XP_014090373 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MILINFLKICTLLIVVAALLPQSQSQRTVCGPALDAVLSTICVHGFNSKFKKSVEWDDLG NNEVDYGLPFPYANSPFLAKIHGAQFDTLAKTRRHRDTVVTGVYDECCSKACSYNEILSY CNTF NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgatactgataaacttcttgaaaatctgcaccttgctgatcgttgtggcagcgttgttg ccacaaagtcaaagccaacgcaccgtttgtggcccggccttggatgctgtactcagcacc atttgcgtccatggcttcaactcaaagttcaagaaatcagtggagtgggatgatctggga aacaatgaagtggactacgggctgccattcccatatgccaactccccattcttagccaag attcacggcgcccaatttgacacgttagccaagactcgtcgccaccgagacacggtggta accggtgtttatgatgaatgttgcagcaaggcctgcagctacaacgagattctttcctat tgcaacacattttaa

DBGET integrated database retrieval system