Bactrocera oleae (olive fruit fly): 106617599 Help Entry 106617599         CDS       T07646                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04068   FoxO signaling pathway bod04081   Hormone signaling bod04140   Autophagy - animal bod04150   mTOR signaling pathway bod04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bod00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106617599    04150 mTOR signaling pathway     106617599   09133 Signaling molecules and interaction    04081 Hormone signaling     106617599  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106617599  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     106617599  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bod04052]     106617599 Cytokines and neuropeptides [BR:bod04052]  Neuropeptides   Unclassified    106617599 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  106617599 NCBI-ProteinID:  XP_014090374 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MILSLLKICAFLTVLLVSLQHISGQQAVCGPAIDAALSLMCENGYNPKFKKSLEWDDIGN TEPKGLSPFGMKDFHFLTKLHGGQVDTVAKTRRRREGVYDECCRKACSYSELLSYCQ NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgattttaagtttgctgaaaatttgcgcttttctaacggttcttctagtcagcttgcaa catatttcggggcaacaggctgtttgcggtccagccatagacgcagcactcagtcttatg tgcgaaaacggctataatccgaagttcaagaaatcactggaatgggatgacataggtaac actgagcccaagggactgtcgcccttcggcatgaaggactttcacttcttaaccaaactt catggcggacaagtcgatacagtagctaaaactcgtcgtcgccgggaaggtgtctacgat gaatgctgccgcaaagcctgctcctacagcgagttgttatcctactgtcaatag

DBGET integrated database retrieval system