Bactrocera oleae (olive fruit fly): 106621677 Help Entry 106621677         CDS       T07646                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     106621677  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bod04121]     106621677    03400 DNA repair and recombination proteins [BR:bod03400]     106621677 Ubiquitin system [BR:bod04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      106621677    Cul5 complex      106621677 DNA repair and recombination proteins [BR:bod03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      106621677 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Ribosomal_S13_N Motif Other DBs NCBI-GeneID:  106621677 NCBI-ProteinID:  XP_014096103 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKENTSVAELKRMIEGILKVRPHDQKLYNQDNEVMEDENTLQD YGIQMSTAKAQAPAQLGLALRDEHGEFEPLEITPYSSPPDLPEVMKNQEAANGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttccttatgattcgaagacataaaaccacaattttcacagatgcaaaagag aatacaagcgtcgcggaactgaagcggatgattgaaggcatcttaaaggtgcgtccccat gaccagaagctatataatcaggataatgaggtgatggaggacgagaacaccttgcaggat tatggcatacagatgtcaacggcaaaggcgcaagctccggcacagttaggactagcatta agagacgaacatggcgaattcgagcctctcgaaataacgccatattcatcaccaccagat ctacctgaagttatgaagaatcaagaggcagctaacggtcaagagcaagttgcataa

DBGET integrated database retrieval system