Bactrocera oleae (olive fruit fly): 106622872 Help Entry 106622872         CDS       T07646                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04013   MAPK signaling pathway - fly bod04145   Phagosome bod04148   Efferocytosis bod04310   Wnt signaling pathway bod04620   Toll-like receptor signaling pathway bod05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bod00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106622872    04310 Wnt signaling pathway     106622872  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106622872    04148 Efferocytosis     106622872  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106622872  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106622872  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bod04131]     106622872   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bod04147]     106622872    04031 GTP-binding proteins [BR:bod04031]     106622872 Membrane trafficking [BR:bod04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106622872  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106622872   Macropinocytosis    Ras GTPases     106622872  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     106622872 Exosome [BR:bod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106622872   Exosomal proteins of other body fluids (saliva and urine)    106622872   Exosomal proteins of colorectal cancer cells    106622872   Exosomal proteins of bladder cancer cells    106622872 GTP-binding proteins [BR:bod04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106622872 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  106622872 NCBI-ProteinID:  XP_014097673 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcaattaagtgcgtcgtggtaggcgatggtgcggtcggtaagacttgcttactt atcagctacacaacaaatgcctttcctggtgaatatattcccactgtgttcgataattac tcggcaaatgtaatggttgatgccaaacccattaatcttggactttgggatactgccgga caagaagattacgatcgcttacgtccattatcgtatccacaaactgatgtttttcttatc tgcttttctttggtgaatccagcgtcatttgaaaacgtacgcgctaagtggtatccggaa gtgcgtcatcattgccctaacacgcccattatattggtgggtaccaaattggacttgcgc gacgataaaaacactattgaaaaactgcgtgacaaaaaactggcacctataacttatcct caaggattatccatggccaaagaaattggtgctgtcaaatatttggaatgttcggcactc acgcaaaaaggtttaaaaacagtatttgatgaagccatacgctccgtcctttgtccagtg ctgcagcccaaatctaaacgtaaatgtacgttactctaa

DBGET integrated database retrieval system