Bactrocera oleae (olive fruit fly): 106627846 Help Entry 106627846         CDS       T07646                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod04814   Motor proteins Brite KEGG Orthology (KO) [BR:bod00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     106627846  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bod03037]     106627846    04812 Cytoskeleton proteins [BR:bod04812]     106627846 Cilium and associated proteins [BR:bod03037]  Motile cilia and associated proteins   Dynein arm    106627846 Cytoskeleton proteins [BR:bod04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      106627846 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light YcxB Leuk-A4-hydro_C Motif Other DBs NCBI-GeneID:  106627846 NCBI-ProteinID:  XP_014103605 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MADEGANPEKEAEKKIVHTYPLVKHSDMNEEMRTEAIEMSITACEKYSSNYEQAARVIKE TMDKKFGIYWHVVVGEGFGFEVSYETKNILYLFFGGNLAILLWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgatgagggagcgaatccggaaaaagaagcagaaaagaaaattgtgcacacatat ccgcttgtcaagcattcagatatgaacgaagaaatgcgaacagaagctatagaaatgagc attacagcttgcgaaaaatattcgagcaattatgagcaagcggcacgtgttatcaaggaa accatggataagaagttcggtatttattggcatgtggttgttggtgaaggctttggattt gaagtctcctacgaaaccaaaaatattttatacctttttttcggtggaaatttagcaatt ttgctatggaaatgttcataa

DBGET integrated database retrieval system