Bactrocera oleae (olive fruit fly): 118679937 Help Entry 118679937         CDS       T07646                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism bod  Bactrocera oleae (olive fruit fly) Brite KEGG Orthology (KO) [BR:bod00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bod03036]     118679937   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bod04147]     118679937 Chromosome and associated proteins [BR:bod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118679937 Exosome [BR:bod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118679937 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931 Motif Other DBs NCBI-GeneID:  118679937 NCBI-ProteinID:  XP_036213597 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MPPKTSGKAAKKAGKAQKNTTKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTA NT seq 286 nt NT seq  +upstreamnt  +downstreamnt atgcctcctaaaactagtggaaaagcagcgaaaaaggctggtaaagcccaaaagaatact actaaaaatgacaagaagaagaagcgcaagaggaaggaaagttatgctatttacatttat aaagtgttgaaacaagtacatccagatacgggtatttcgtcaaaagccatgagtatcatg aacagttttgtaaatgatatttttgagcgtatcgctgccgaagcatcgcgtttagctcac tacaacaaacgttcaactatcactagtcgcgaaatccaaactgctg

DBGET integrated database retrieval system