Brassica oleracea (wild cabbage): 106293851 Help Entry 106293851         CDS       T04124                                  Name (RefSeq) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism boe  Brassica oleracea (wild cabbage) Brite KEGG Orthology (KO) [BR:boe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:boe03110]     106293851    03029 Mitochondrial biogenesis [BR:boe03029]     106293851 Chaperones and folding catalysts [BR:boe03110]  Heat shock proteins   HSP10    106293851 Mitochondrial biogenesis [BR:boe03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     106293851 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  106293851 NCBI-ProteinID:  XP_013584941 UniProt:  A0A0D3CCM3 LinkDB All DBs Position C5:12670811..12671437 Genome browser AA seq 97 aa AA seqDB search MAKRLIPTLNRVLVEKILQPSKTVSGILLPETSSQLNSGRVIAVGPGARDRTGNLIPVSV KEGDSVLLPKFGGTQVKLGEKEFLLYRDEDLMATLHD NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcgaagcgattgatcccgacgttaaaccgtgtgttggttgagaagattcttcaaccg tcgaagaccgtctccggcattctcctaccggaaacatcttctcagttgaattcggggagg gtgatagcagttggtcctggagcgagagacagaaccgggaatctgattccggtttcggtt aaggaaggagacagtgttcttttgcctaagttcggtggtactcaagtgaagctcggagag aaagagtttcttttgtatagggatgaagatctcatggctactcttcatgattga

DBGET integrated database retrieval system