Brassica oleracea (wild cabbage): 106296663 Help Entry 106296663         CDS       T04124                                  Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism boe  Brassica oleracea (wild cabbage) Pathway boe03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     106296663  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:boe03400]     106296663 DNA repair and recombination proteins [BR:boe03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      106296663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Arm_3 Motif Other DBs NCBI-GeneID:  106296663 NCBI-ProteinID:  XP_013588308 UniProt:  A0A0D3D1N6 LinkDB All DBs Position C6:complement(39043278..39045450) Genome browser AA seq 104 aa AA seqDB search MDANNAFDSDLIHAIFKHIWARRFRERERSDAIDATDAEVALGTSKKNRLASANANALKL SCELLKSFVSEAVQRAAIIAEAEGMDKIEASHLERILPQLLLDF NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggacgccaacaatgctttcgattctgatctgattcacgccattttcaagcacatttgg gcccgaagatttcgcgaaagagagaggagtgatgcaattgatgctacagacgctgaggtt gctttgggaacatccaagaagaacagacttgcttctgccaacgcgaatgctctgaaactt agctgtgagcttctcaagagctttgtctcagaggctgtgcagcgcgcggctataattgcg gaagctgaggggatggataagattgaagcgagtcatttggagaggattcttcctcagctt cttttggacttttaa

DBGET integrated database retrieval system