Brassica oleracea (wild cabbage): 106301080 Help Entry 106301080         CDS       T04124                                  Name (RefSeq) sm-like protein LSM36B   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism boe  Brassica oleracea (wild cabbage) Pathway boe03018   RNA degradation boe03040   Spliceosome Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     106301080   09123 Folding, sorting and degradation    03018 RNA degradation     106301080  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:boe03019]     106301080    03041 Spliceosome [BR:boe03041]     106301080 Messenger RNA biogenesis [BR:boe03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      106301080   mRNA degradation factors    5'-3' decay     Lsm complex      106301080 Spliceosome [BR:boe03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     106301080 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  106301080 NCBI-ProteinID:  XP_013592846 UniProt:  A0A0D3CUV2 LinkDB All DBs Position C6 Genome browser AA seq 91 aa AA seqDB search MSGSGDKVVGTTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVN GQLKNKYGDAFIRGNNVLYISTVKGPLADGA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtggaagtggagataaagttgttggaaccacaaagacacctgctgatttcctcaaa tccatccgtgggagacccgttgttgtcaaactcaactctggtgttgattatcgaggcatt cttgcttgtcttgatgggtatatgaacatagcaatggagcagacagaggagtatgtcaac ggccagctcaagaacaaatacggtgatgcctttatccgtggaaacaatgttctttacatc agtacagtgaagggacccttggcggacggagcttag

DBGET integrated database retrieval system