Brassica oleracea (wild cabbage): 106304816 Help Entry 106304816         CDS       T04124                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism boe  Brassica oleracea (wild cabbage) Pathway boe03083   Polycomb repressive complex boe04120   Ubiquitin mediated proteolysis boe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106304816    04120 Ubiquitin mediated proteolysis     106304816   09126 Chromosome    03083 Polycomb repressive complex     106304816  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:boe04131]     106304816    04121 Ubiquitin system [BR:boe04121]     106304816    03036 Chromosome and associated proteins [BR:boe03036]     106304816 Membrane trafficking [BR:boe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     106304816 Ubiquitin system [BR:boe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      106304816    Cul7 complex      106304816 Chromosome and associated proteins [BR:boe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      106304816   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      106304816 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ MRP-S27 Motif Other DBs NCBI-GeneID:  106304816 NCBI-ProteinID:  XP_013596659 UniProt:  A0A0D3DAI7 LinkDB All DBs Position C7:31111717..31112349 Genome browser AA seq 152 aa AA seqDB search MITLTSSDGECFEIEEAVARKFEIVANMIEDDCASGSIPLANVAAKALGAAIEYCKTHVE AGAVESNEAAADKLKKWDDEFLAKYDNAMLFDLLTAANYLNCKGLLDLTCQKVADNIKDL SPEDVRTIFNIQNDFSEEEEADVRKENEWAFN NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgattacgttgactagctccgatggcgagtgttttgagattgaagaagcggtggcgcgt aagttcgagatcgtagcaaacatgatcgaagacgactgcgccagtggatcgatcccatta gcaaacgtagccgcgaaggccctaggcgcagcgatcgagtattgcaagacgcacgtcgaa gctggtgcggtcgaaagcaacgaggcggctgcggataaactcaagaagtgggacgatgaa tttttggctaaatatgataatgctatgctgttcgatcttttgaccgctgctaactatcta aactgcaaaggccttctcgacctcacatgccaaaaggtcgcagataacatcaaagacttg tcaccagaggacgtccgcacgattttcaacatccagaatgatttttcagaagaagaagaa gcagatgttcgtaaggagaacgaatgggcttttaattag

DBGET integrated database retrieval system