Brassica oleracea (wild cabbage): 106305191 Help Entry 106305191         CDS       T04124                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism boe  Brassica oleracea (wild cabbage) Pathway boe03083   Polycomb repressive complex boe04120   Ubiquitin mediated proteolysis boe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106305191    04120 Ubiquitin mediated proteolysis     106305191   09126 Chromosome    03083 Polycomb repressive complex     106305191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:boe04131]     106305191    04121 Ubiquitin system [BR:boe04121]     106305191    03036 Chromosome and associated proteins [BR:boe03036]     106305191 Membrane trafficking [BR:boe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     106305191 Ubiquitin system [BR:boe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      106305191    Cul7 complex      106305191 Chromosome and associated proteins [BR:boe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      106305191   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      106305191 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  106305191 NCBI-ProteinID:  XP_013597015 UniProt:  A0A0D3D7V8 LinkDB All DBs Position C7:complement(22812189..22812746) Genome browser AA seq 152 aa AA seqDB search MSKKITLKSSDGISFQVDEAVALMSPRIKRMIEDDRTGNGITIPNVNSAALAKVIEYCKK HVEANADDTELKAWDLDFARALEGLDKDTFFAVTSAAHFLNIGGLFDLTCKTVAEMVRGK TVDQIRDIFHIKNDYTDAEEAKMRKENAWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagatcaccctcaagagctccgacggcatatctttccaggtcgatgaagcc gttgcgctcatgtctccgagaatcaagcgcatgatcgaagacgaccgcaccggtaatgga atcactattccaaacgtgaacagtgcagccctcgcaaaggttatcgagtactgcaagaag cacgtcgaagccaacgctgatgacactgagctcaaggcttgggacttagatttcgccaga gctctcgagggcctcgacaaggatactttcttcgctgtcacctctgctgcacattttctg aacatcggtggactttttgacctaacgtgcaagactgtggccgaaatggtgagaggcaag actgtagatcagattcgcgatatcttccacatcaagaacgactatacagatgcggaagaa gctaagatgcgcaaggagaatgcatgggcctttgagtga

DBGET integrated database retrieval system