Brassica oleracea (wild cabbage): 106310363 Help Entry 106310363         CDS       T04124                                  Name (RefSeq) 10 kDa chaperonin-like   KO K04078   chaperonin GroES Organism boe  Brassica oleracea (wild cabbage) Brite KEGG Orthology (KO) [BR:boe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:boe03110]     106310363    03029 Mitochondrial biogenesis [BR:boe03029]     106310363 Chaperones and folding catalysts [BR:boe03110]  Heat shock proteins   HSP10    106310363 Mitochondrial biogenesis [BR:boe03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     106310363 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 RNF6_N Motif Other DBs NCBI-GeneID:  106310363 NCBI-ProteinID:  XP_013603047 UniProt:  A0A0D3DX82 LinkDB All DBs Position C8 Genome browser AA seq 98 aa AA seqDB search MMKRLVPTFNRILVQRVIQPAKTESGILLPEKASSLNSGKVIAVGPGSRDKDGKLIPVSV KEGDTVLLPEYGGTQVKLGDNEYHLFRDEDVLGTLHED NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgaagcgtctggtcccaacgttcaaccgcatcctggtgcagagagtcatccagcct gctaaaaccgagagcggcatcctcctcccagagaaagcctcctcgttgaactcgggcaag gtgatagcagtgggacctggttcaagggacaaagatgggaaattgattccggtctctgtc aaggaaggcgacaccgttcttcttcccgagtacggtggtactcaggtcaagctcggcgac aatgagtaccatctcttccgggatgaggacgtcttgggaaccttgcacgaggactga

DBGET integrated database retrieval system