Brassica oleracea (wild cabbage): 106311544 Help Entry 106311544         CDS       T04124                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism boe  Brassica oleracea (wild cabbage) Pathway boe03083   Polycomb repressive complex boe04120   Ubiquitin mediated proteolysis boe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106311544    04120 Ubiquitin mediated proteolysis     106311544   09126 Chromosome    03083 Polycomb repressive complex     106311544  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:boe04131]     106311544    04121 Ubiquitin system [BR:boe04121]     106311544    03036 Chromosome and associated proteins [BR:boe03036]     106311544 Membrane trafficking [BR:boe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     106311544 Ubiquitin system [BR:boe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      106311544    Cul7 complex      106311544 Chromosome and associated proteins [BR:boe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      106311544   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      106311544 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 NAF Motif Other DBs NCBI-GeneID:  106311544 NCBI-ProteinID:  XP_013604197 UniProt:  A0A0D3DUG4 LinkDB All DBs Position C8:32196035..32196606 Genome browser AA seq 153 aa AA seqDB search MEMFVLKSSDDESFEVDEAVVLQSQLLSNLFEDCSGARECKIDEVTGEVLSKVVEYCKNH VVVVVDGGANSSSSGDALKKWDAEFITRMDLSMVFDLIMTANYLNIKGLFDLTCQRVADE IAACKDHKEIRAKFGIVSDYTAEEEAEVLKENE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgttcgtgttgaagagctccgacgatgaatcctttgaagtggacgaagcggtg gtacttcagtcgcagctcttgtcgaatctttttgaagattgcagcggcgctcgtgaatgc aagattgacgaggtcacaggcgaagtcctctcgaaggtggtcgagtactgcaagaaccac gtcgtagtcgtcgtcgacggtggtgccaattcttcttcctccggtgatgctctcaagaag tgggacgctgagttcatcacgcgaatggatctgtccatggtctttgacctcatcatgact gcgaactacctaaacatcaaaggtctttttgatctcacgtgccagagagtcgctgatgag atcgcagcttgcaaagaccataaggagattcgcgcaaagttcggcatcgtgagtgactac acagcggaggaggaagcagaggttctcaaggagaacgagtga

DBGET integrated database retrieval system