Brassica oleracea (wild cabbage): 106340237 Help Entry 106340237         CDS       T04124                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism boe  Brassica oleracea (wild cabbage) Pathway boe03083   Polycomb repressive complex boe04120   Ubiquitin mediated proteolysis boe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:boe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106340237    04120 Ubiquitin mediated proteolysis     106340237   09126 Chromosome    03083 Polycomb repressive complex     106340237  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:boe04131]     106340237    04121 Ubiquitin system [BR:boe04121]     106340237    03036 Chromosome and associated proteins [BR:boe03036]     106340237 Membrane trafficking [BR:boe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     106340237 Ubiquitin system [BR:boe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      106340237    Cul7 complex      106340237 Chromosome and associated proteins [BR:boe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      106340237   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      106340237 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  106340237 NCBI-ProteinID:  XP_013634573 UniProt:  A0A0D3BWS2 LinkDB All DBs Position C4:26573952..26574752 Genome browser AA seq 154 aa AA seqDB search MSTKKILFKSSDGHLFEADEAVARQSTTISHSLEDCCAKADDEFLLPNVSGNILSLVIEY CKKHADVGSISEEDLKKWDAEFVLGMDQPTFFDLIRASNYQNIPSLIALTCQTIANLIAD PNEIRATFEIKNDFTPEEEEKGRQENRWAFHLSH NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtctacgaaaaagatcttgtttaagagctccgatggtcacttgttcgaggccgacgaa gctgtcgcacgccaatcgacgacgatatcacattcccttgaagattgctgcgccaaggcc gacgatgagttcctgcttccgaacgtctccggcaacatcctcagcttagtgatcgagtac tgcaagaagcacgccgacgttggctccatctccgaggaagatctcaagaagtgggacgcc gagttcgtcttgggtatggatcagcccacgttcttcgatctcatccgggcttcgaactac cagaacatcccaagcctgattgctctaacttgccagacgatcgctaatttgatcgcggac ccaaatgagattcgcgcaacgttcgagatcaagaacgattttacaccggaggaagaagaa aaaggtcgccaggagaatcgatgggcctttcatttgagtcattag

DBGET integrated database retrieval system