Bosea sp. F3-2: FQV39_17315 Help Entry FQV39_17315       CDS       T06223                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bof  Bosea sp. F3-2 Brite KEGG Orthology (KO) [BR:bof00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bof03110]     FQV39_17315 (grxC) Chaperones and folding catalysts [BR:bof03110]  Protein folding catalysts   Protein disulfide isomerase    FQV39_17315 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 SH3BGR Thioredoxin Thioredoxin_3 TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  QEL26641 UniProt:  A0A5C1B811 LinkDB All DBs Position 3762711..3762968 Genome browser AA seq 85 aa AA seqDB search MPPVTIYTTSWCPYCKAAKALLTRKGVAFSEIDVDGEPELRQAMTARAGGRTSVPQIFIG ERHVGGSDDIHALDARGELDGLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccgccggtcacgatctacaccacctcctggtgcccctattgcaaggccgccaaggcc ctgctgacccggaagggcgtcgccttctcggagatcgatgtcgacggcgagccggaactg cggcaggccatgacggcacgggcaggcgggcgtacttcggtgccacagatcttcatcggc gagcgccatgtcggcggctccgacgatatccacgccctcgatgcccgcggcgaactcgac gggctgctggcggcctga

DBGET integrated database retrieval system